Detailed information of TA system TA000175

Experimentally validated

Overview

TA module

• Type: II
• Classification (family/domain): relBE/PHD-RelE
• Location: 419979..420528
• Replicon: chromosome II
• Accession: NC_002506
• Organism: Vibrio cholerae O1 biovar El Tor str. N16961

Toxin (Protein)

• Gene name: relE
• Uniprot ID: A0A0X1KZS6
• Locus tag: VC_RS15705
• Protein ID: WP_000221354.1
• Coordinates: 420241..420528 (+)
• Length: 96 a.a.

Antitoxin (Protein)

• Gene name: relB
• Uniprot ID: A0A0X1KZS8
• Locus tag: VC_RS15700
• Protein ID: WP_001250179.1
• Coordinates: 420000..420251 (+)
• Length: 84 a.a.

Genomic Context

Location: 415268..415582 (315 bp)
Type: Others
Protein ID: WP_000071008.1

Location: 415719..416153 (435 bp)
Type: Others
Protein ID: WP_000256036.1

Location: 416321..416476 (156 bp)
Type: Others
Protein ID: WP_000751734.1

Location: 417649..417955 (307 bp)
Type: Others
Protein ID: Protein_446

Location: 418092..418784 (693 bp)
Type: Others
Protein ID: WP_001047169.1

Location: 418784..419185 (402 bp)
Type: Others
Protein ID: WP_000351248.1

Location: 419155..419298 (144 bp)
Type: Others
Protein ID: WP_071908341.1

Location: 419373..419786 (414 bp)
Type: Others
Protein ID: WP_000049417.1

Location: 420000..420251 (252 bp)
Type: Antitoxin
Protein ID: WP_001250179.1

Location: 420241..420528 (288 bp)
Type: Toxin
Protein ID: WP_000221354.1

Location: 420656..421111 (456 bp)
Type: Others
Protein ID: WP_001245327.1

Location: 421433..421585 (153 bp)
Type: Others
Protein ID: WP_001884520.1

Location: 422784..423452 (669 bp)
Type: Others
Protein ID: WP_000043871.1

Location: 423604..423891 (288 bp)
Type: Others
Protein ID: WP_000426470.1

Location: 424032..424403 (372 bp)
Type: Others
Protein ID: WP_001164080.1

Location: 424470..424895 (426 bp)
Type: Others
Protein ID: WP_001882332.1

Location: 424892..425425 (534 bp)
Type: Others
Protein ID: WP_000118351.1

Location: 416601..417581 (981 bp)
Type: Others
Protein ID: WP_000019370.1

Location: 421787..422284 (498 bp)
Type: Others
Protein ID: WP_000982260.1

Location: 422281..422553 (273 bp)
Type: Others
Protein ID: WP_000246253.1

Loading, please wait

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
VC_RS15655 (VC_A0469)	415268..415582	+	315	WP_000071008.1	DNA-binding transcriptional regulator	-
VC_RS15660 (VC_A0470)	415719..416153	+	435	WP_000256036.1	GNAT family N-acetyltransferase	-
VC_RS15665 (VC_A0471)	416321..416476	+	156	WP_000751734.1	hypothetical protein	-
VC_RS15670 (VC_A0472)	416601..417581	-	981	WP_000019370.1	IS5-like element ISVch5 family transposase	-
VC_RS15675 (VC_A0473)	417649..417955	+	307	Protein_446	CatB-related O-acetyltransferase	-
VC_RS15680 (VC_A0474)	418092..418784	+	693	WP_001047169.1	GNAT family N-acetyltransferase	-
VC_RS15685 (VC_A0475)	418784..419185	+	402	WP_000351248.1	type II toxin-antitoxin system death-on-curing family toxin	-
VC_RS15690	419155..419298	+	144	WP_071908341.1	DUF3265 domain-containing protein	-
VC_RS15695 (VC_A0476)	419373..419786	+	414	WP_000049417.1	VOC family protein	-
VC_RS15700 (VC_A0477)	420000..420251	+	252	WP_001250179.1	type II toxin-antitoxin system Phd/YefM family antitoxin	Antitoxin
VC_RS15705 (VC_A0478)	420241..420528	+	288	WP_000221354.1	type II toxin-antitoxin system RelE/ParE family toxin	Toxin
VC_RS15710 (VC_A0479)	420656..421111	+	456	WP_001245327.1	GNAT family N-acetyltransferase	-
VC_RS15715 (VC_A0480)	421433..421585	+	153	WP_001884520.1	DUF645 family protein	-
VC_RS15720 (VC_A0481)	421787..422284	-	498	WP_000982260.1	GNAT family N-acetyltransferase	-
VC_RS15725 (VC_A0482)	422281..422553	-	273	WP_000246253.1	DUF1778 domain-containing protein	-
VC_RS15730 (VC_A0483)	422784..423452	+	669	WP_000043871.1	hypothetical protein	-
VC_RS15735 (VC_A0484)	423604..423891	+	288	WP_000426470.1	hypothetical protein	-
VC_RS15740 (VC_A0485)	424032..424403	+	372	WP_001164080.1	nucleotide pyrophosphohydrolase	-
VC_RS15745 (VC_A0486)	424470..424895	+	426	WP_001882332.1	DUF1778 domain-containing protein	-
VC_RS15750 (VC_A0487)	424892..425425	+	534	WP_000118351.1	GNAT family N-acetyltransferase	-

Associated MGEs

Loading, please wait

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)
	Similar MGE(s) Similar MGE(s) is defined as other TA-related MGE(s) with Mash distance < 0.01 to this MGE. Detail Genome accession Organism MGE type Related TA Coordinates Mash distance View NC_009456 Vibrio cholerae O395 IS/Tn TA022075, TA022076, TA022077 837110..838090 0 View NC_012580 Vibrio cholerae M66-2 IS/Tn TA023713, TA023714, TA023715, TA023716 392295..393275 0 View NC_012583 Vibrio cholerae O395 IS/Tn TA023732, TA023733, TA023734 425852..426832 0 View NC_012667 Vibrio cholerae MJ-1236 IS/Tn TA023783, TA023784, TA023785, TA023786 968666..969646 0 View NC_016446 Vibrio cholerae O1 str. 2010EL-1786 IS/Tn TA025714, TA025715, TA025716, TA025717 117142..118122 0 View NC_016945 Vibrio cholerae IEC224 IS/Tn TA026152, TA026153, TA026154, TA026155 416420..417400 0 View NZ_AP018677 Vibrio cholerae strain V060002 IS/Tn TA031954, TA031955, TA031956, TA031957 1529544..1530524 0 View NZ_AP024548 Vibrio cholerae strain BCH-01536 IS/Tn TA038625, TA038626, TA038627, TA038628 94862..95842 0 View NZ_AP024550 Vibrio cholerae strain IDH-00113 IS/Tn TA038642, TA038643, TA038644, TA038645 869451..870431 0 View NZ_AP024552 Vibrio cholerae strain IDH-02387 IS/Tn TA038654, TA038655, TA038656 690582..691562 0 View NZ_AP024554 Vibrio cholerae strain IDH-03329 IS/Tn TA038672, TA038673, TA038674, TA038675 230925..231905 0 View NZ_AP024556 Vibrio cholerae strain IDH-03506 IS/Tn TA038695, TA038696, TA038697 68951..69931 0 View NZ_CP006948 Vibrio cholerae O1 str. KW3 IS/Tn TA045811, TA045812, TA045813, TA045814 391976..392956 0 View NZ_CP007635 Vibrio cholerae strain 2012EL-2176 IS/Tn TA046758, TA046759, TA046760, TA046761 118380..119360 0 View NZ_CP009041 Vibrio cholerae O1 biovar El Tor strain FJ147 IS/Tn TA048154, TA048155, TA048156, TA048157 390730..391710 0 View NZ_CP012666 Vibrio cholerae strain ICDC-VC661 IS/Tn TA056917, TA056918, TA056919, TA056920 380730..381710 0 View NZ_CP012997 Vibrio cholerae strain 2012Env-9 IS/Tn TA057656, TA057657, TA057658, TA057659, TA057660, TA057661 843313..844293 0.001 View NZ_CP012997 Vibrio cholerae strain 2012Env-9 IS/Tn TA057659, TA057660, TA057661 849893..850873 0.001 View NZ_CP013013 Vibrio cholerae strain Env-390 IS/Tn TA057703, TA057704, TA057705, TA057706, TA057707, TA057708 844511..845491 0.001 View NZ_CP013013 Vibrio cholerae strain Env-390 IS/Tn TA057706, TA057707, TA057708 851091..852071 0.001 View NZ_CP013302 Vibrio cholerae strain C5 IS/Tn TA058227, TA058228, TA058229, TA058230 450124..451104 0 View NZ_CP013304 Vibrio cholerae strain CRC711 IS/Tn TA058248, TA058249, TA058250, TA058251 408512..409492 0 View NZ_CP013306 Vibrio cholerae strain CRC1106 IS/Tn TA058272, TA058273, TA058274, TA058275 444389..445369 0 View NZ_CP013308 Vibrio cholerae strain E506 IS/Tn TA058291, TA058292, TA058293, TA058294 435265..436245 0 View NZ_CP013310 Vibrio cholerae strain E1162 IS/Tn TA058315, TA058316, TA058317, TA058318 577497..578477 0 View NZ_CP013312 Vibrio cholerae strain E1320 IS/Tn TA058338, TA058339, TA058340, TA058341 824372..825352 0 View NZ_CP013314 Vibrio cholerae strain E9120 IS/Tn TA058362, TA058363, TA058364, TA058365 449302..450282 0 View NZ_CP013318 Vibrio cholerae strain NCTC5395 IS/Tn TA058403, TA058404, TA058405, TA058406 477671..478651 0 View NZ_CP013320 Vibrio cholerae strain NCTC9420 IS/Tn TA058424, TA058425, TA058426, TA058427 417076..418056 0 View NZ_CP016325 Vibrio cholerae 2740-80 IS/Tn TA064439, TA064440, TA064441, TA064442 435420..436400 0 View NZ_CP020407 Vibrio cholerae strain FDAARGOS_223 IS/Tn TA074619, TA074620, TA074621, TA074622 767269..768249 0 View NZ_CP024163 Vibrio cholerae strain E7946 IS/Tn TA087025, TA087026, TA087027, TA087028 414782..415762 0 View NZ_CP024868 Vibrio cholerae strain A1552 IS/Tn TA088996, TA088997, TA088998, TA088999 414816..415796 0 View NZ_CP025937 Vibrio cholerae strain A1552 IS/Tn TA092511, TA092512, TA092513, TA092514 414166..415146 0.001 View NZ_CP026648 Vibrio cholerae O1 biovar El Tor strain HC1037 IS/Tn TA095384, TA095385, TA095386, TA095387 117072..118052 0 View NZ_CP028828 Vibrio cholerae strain N16961 IS/Tn TA104259, TA104256, TA104257, TA104258 418911..419891 0 View NZ_CP028895 Vibrio cholerae strain A1552 IS/Tn TA104344, TA104345, TA104346, TA104347 417013..417993 0 View NZ_CP033513 Vibrio cholerae strain E4 IS/Tn TA113799, TA113800, TA113801, TA113802 144945..145925 0 View NZ_CP040173 Vibrio cholerae strain VC1374 IS/Tn TA125044, TA125045, TA125046, TA125047 958940..959659 0.009 View NZ_CP042300 Vibrio cholerae O1 strain AAS91 IS/Tn TA135195, TA135196, TA135197, TA135198, TA135199, TA135200 843306..844286 0.001 View NZ_CP042300 Vibrio cholerae O1 strain AAS91 IS/Tn TA135198, TA135199, TA135200 849886..850866 0.001 View NZ_CP045718 Vibrio cholerae O395 substr. TCP2 IS/Tn TA142373, TA142374, TA142375 836659..837639 0 View NZ_CP046743 Vibrio cholerae strain 3569-08 IS/Tn TA144871, TA144872, TA144873, TA144874 590661..591641 0 View NZ_CP046841 Vibrio cholerae strain F9993 IS/Tn TA145061, TA145062, TA145063, TA145064 340238..341218 0 View NZ_CP046845 Vibrio cholerae C6706 IS/Tn TA145079, TA145080, TA145081, TA145082 16835..17815 0 View NZ_CP047060 Vibrio cholerae isolate CTMA_1441 IS/Tn TA145401, TA145402, TA145403, TA145404 391997..392977 0 View NZ_CP047296 Vibrio cholerae C6706 IS/Tn TA145814, TA145815, TA145816, TA145813 417003..417983 0 View NZ_CP047298 Vibrio cholerae O1 biovar El Tor strain C6709 IS/Tn TA145833, TA145834, TA145835, TA145836 417000..417980 0 View NZ_CP047300 Vibrio cholerae O1 biovar El Tor strain P27459 IS/Tn TA145853, TA145854, TA145855, TA145856 420130..421110 0 View NZ_CP047302 Vibrio cholerae O1 biovar El Tor strain DRC-193A IS/Tn TA145873, TA145874, TA145875, TA145876 391974..392954 0 View NZ_CP047304 Vibrio cholerae O1 biovar El Tor strain E7946 IS/Tn TA145893, TA145894, TA145895, TA145896 417589..418569 0 View NZ_CP047306 Vibrio cholerae O37 strain ATCC 25872 IS/Tn TA145911, TA145912, TA145913, TA145914 414094..415074 0 View NZ_CP064351 Vibrio cholerae C6706 IS/Tn TA180874, TA180875, TA180876, TA180877 483302..484282 0 View NZ_CP072848 Vibrio cholerae strain A1552 IS/Tn TA198989, TA198987, TA198988, TA198990 417013..417993 0 View NZ_CP072850 Vibrio cholerae MO10 IS/Tn TA199006, TA199007, TA199008, TA199009 383027..384007 0 View NZ_CP077061 Vibrio cholerae strain MS84A IS/Tn TA206601, TA206602, TA206603, TA206604 10051..11031 0 View NZ_CP080466 Vibrio cholerae strain ICDC-VC3741 IS/Tn TA211910, TA211911, TA211912, TA211913 950862..951842 0 View NZ_CP090379 Vibrio cholerae strain BY369 IS/Tn TA230523, TA230524, TA230525, TA230526 380730..381710 0 View NZ_CP090400 Vibrio cholerae strain PanChol IS/Tn TA230639, TA230640, TA230641, TA230642 853825..854805 0 View NZ_CP102928 Vibrio cholerae strain N1252 IS/Tn TA254474, TA254475, TA254476, TA254477 801195..802175 0 View NZ_LT906615 Vibrio cholerae O1 biovar El Tor str. N16961 IS/Tn TA293804, TA293801, TA293802, TA293803 416599..417579 0 View NZ_LT907990 Vibrio cholerae strain A19 IS/Tn TA293830, TA293831, TA293832, TA293833 416599..417579 0 View NZ_LT992487 Vibrio cholerae strain 4295STDY6534216 IS/Tn TA294353, TA294354, TA294355, TA294356 915707..916687 0 View NZ_LT992489 Vibrio cholerae strain 4295STDY6534232 IS/Tn TA294373, TA294374, TA294375, TA294376 397507..398487 0 View NZ_LT992493 Vibrio cholerae strain 4295STDY6534248 IS/Tn TA294414, TA294415, TA294416, TA294417 273870..274850 0 View NZ_OW443148 Vibrio cholerae strain CNRVC190243 isolate YE-NCPHL-19014-PI IS/Tn TA295395, TA295396, TA295397, TA295398 437248..438228 0	flank	IS/Tn	-	-	416601..417581	980
	Similar MGE(s) Similar MGE(s) is defined as other TA-related MGE(s) with Mash distance < 0.01 to this MGE. Detail Genome accession Organism MGE type Related TA Coordinates Mash distance View NC_012667 Vibrio cholerae MJ-1236 Integron TA023781, TA023782, TA023783, TA023784, TA023785, TA023786, TA023787, TA023788, TA023789, TA023790, TA023791, TA023792, TA023793, TA023794, TA023795 958376..1050596 0.006 View NC_016446 Vibrio cholerae O1 str. 2010EL-1786 Integron TA025705, TA025706, TA025707, TA025708, TA025709, TA025710, TA025711, TA025712, TA025713, TA025714, TA025715, TA025716, TA025717, TA025718, TA025719, TA025720, TA025721, TA025722 36195..135928 0.004 View NC_016945 Vibrio cholerae IEC224 Integron TA026143, TA026144, TA026145, TA026146, TA026147, TA026148, TA026149, TA026150, TA026151, TA026152, TA026153, TA026154, TA026155, TA026156, TA026157, TA026158, TA026159, TA026160 309717..435206 0 View NZ_AP024548 Vibrio cholerae strain BCH-01536 Integron TA038617, TA038618, TA038619, TA038620, TA038621, TA038622, TA038623, TA038624, TA038625, TA038626, TA038627, TA038628, TA038629, TA038630, TA038631, TA038632 11978..113648 0.004 View NZ_AP024554 Vibrio cholerae strain IDH-03329 Integron TA038668, TA038669, TA038670, TA038671, TA038672, TA038673, TA038674, TA038675, TA038676, TA038677, TA038678, TA038679, TA038680, TA038681, TA038682, TA038683, TA038684 213119..312856 0.004 View NZ_CP006948 Vibrio cholerae O1 str. KW3 Integron TA045802, TA045803, TA045804, TA045805, TA045806, TA045807, TA045808, TA045809, TA045810, TA045811, TA045812, TA045813, TA045814, TA045815, TA045816, TA045817, TA045818, TA045819 309725..410760 0.004 View NZ_CP007635 Vibrio cholerae strain 2012EL-2176 Integron TA046749, TA046750, TA046751, TA046752, TA046753, TA046754, TA046755, TA046756, TA046757, TA046758, TA046759, TA046760, TA046761, TA046762, TA046763, TA046764, TA046765, TA046766 36117..137166 0.004 View NZ_CP009041 Vibrio cholerae O1 biovar El Tor strain FJ147 Integron TA048145, TA048146, TA048147, TA048148, TA048149, TA048150, TA048151, TA048152, TA048153, TA048154, TA048155, TA048156, TA048157, TA048158, TA048159, TA048160, TA048161, TA048162 309780..409516 0.004 View NZ_CP012666 Vibrio cholerae strain ICDC-VC661 Integron TA056924, TA056909, TA056910, TA056911, TA056912, TA056913, TA056914, TA056915, TA056916, TA056917, TA056918, TA056919, TA056920, TA056921, TA056922, TA056923, TA056925 309725..399516 0.005 View NZ_CP013302 Vibrio cholerae strain C5 Integron TA058213, TA058214, TA058215, TA058216, TA058217, TA058218, TA058219, TA058220, TA058221, TA058222, TA058223, TA058224, TA058225, TA058226, TA058227, TA058228, TA058229, TA058230, TA058231, TA058232, TA058233, TA058234, TA058235 309774..468910 0.005 View NZ_CP013306 Vibrio cholerae strain CRC1106 Integron TA058258, TA058259, TA058260, TA058261, TA058262, TA058263, TA058264, TA058265, TA058266, TA058267, TA058268, TA058269, TA058270, TA058271, TA058272, TA058273, TA058274, TA058275, TA058276, TA058277, TA058278, TA058279, TA058280 309821..463174 0.006 View NZ_CP013310 Vibrio cholerae strain E1162 Integron TA058301, TA058302, TA058303, TA058304, TA058305, TA058306, TA058307, TA058308, TA058309, TA058310, TA058311, TA058312, TA058313, TA058314, TA058315, TA058316, TA058317, TA058318, TA058319, TA058320, TA058321, TA058322, TA058323 440614..596283 0.005 View NZ_CP013314 Vibrio cholerae strain E9120 Integron TA058348, TA058349, TA058350, TA058351, TA058352, TA058353, TA058354, TA058355, TA058356, TA058357, TA058358, TA058359, TA058360, TA058361, TA058362, TA058363, TA058364, TA058365, TA058366, TA058367, TA058368, TA058369, TA058370 309780..468088 0.005 View NZ_CP013316 Vibrio cholerae strain M2140 Integron TA058372, TA058373, TA058374, TA058375, TA058376, TA058377, TA058378, TA058379, TA058380, TA058381, TA058382, TA058383, TA058384, TA058385, TA058386, TA058387, TA058388, TA058389 93061..221594 0.008 View NZ_CP013318 Vibrio cholerae strain NCTC5395 Integron TA058391, TA058392, TA058393, TA058394, TA058395, TA058396, TA058397, TA058398, TA058399, TA058400, TA058401, TA058402, TA058403, TA058404, TA058405, TA058406, TA058407, TA058408, TA058409, TA058410, TA058411 343365..496457 0.009 View NZ_CP020407 Vibrio cholerae strain FDAARGOS_223 Integron TA074614, TA074615, TA074616, TA074617, TA074618, TA074619, TA074620, TA074621, TA074622, TA074623, TA074624, TA074625, TA074626, TA074627, TA074628, TA074629, TA074630, TA074631 749463..875103 0 View NZ_CP024163 Vibrio cholerae strain E7946 Integron TA087016, TA087017, TA087018, TA087019, TA087020, TA087021, TA087022, TA087023, TA087024, TA087025, TA087026, TA087027, TA087028, TA087029, TA087030, TA087031, TA087032, TA087033 309306..433568 0 View NZ_CP024868 Vibrio cholerae strain A1552 Integron TA088996, TA088997, TA088987, TA088988, TA088989, TA088990, TA088991, TA088992, TA088993, TA088994, TA088995, TA088998, TA088999, TA089000, TA089001, TA089002, TA089003, TA089004 309797..433602 0 View NZ_CP025937 Vibrio cholerae strain A1552 Integron TA092502, TA092503, TA092504, TA092505, TA092506, TA092507, TA092508, TA092509, TA092510, TA092511, TA092512, TA092513, TA092514, TA092515, TA092516, TA092517, TA092518, TA092519 309147..432952 0 View NZ_CP026648 Vibrio cholerae O1 biovar El Tor strain HC1037 Integron TA095391, TA095375, TA095376, TA095377, TA095378, TA095379, TA095380, TA095381, TA095382, TA095383, TA095384, TA095385, TA095386, TA095387, TA095388, TA095389, TA095390, TA095392 36123..135858 0.004 View NZ_CP028828 Vibrio cholerae strain N16961 Integron TA104260, TA104261, TA104247, TA104248, TA104249, TA104250, TA104251, TA104252, TA104253, TA104254, TA104255, TA104256, TA104257, TA104258, TA104259, TA104262, TA104263, TA104264 312057..437697 0 View NZ_CP028895 Vibrio cholerae strain A1552 Integron TA104335, TA104336, TA104337, TA104338, TA104339, TA104340, TA104341, TA104342, TA104343, TA104344, TA104345, TA104346, TA104347, TA104348, TA104349, TA104350, TA104351, TA104352 311994..435799 0 View NZ_CP033513 Vibrio cholerae strain E4 Integron TA113805, TA113806, TA113807, TA113808, TA113794, TA113795, TA113796, TA113797, TA113798, TA113799, TA113800, TA113801, TA113802, TA113803, TA113804, TA113809, TA113810, TA113811 127139..226875 0.004 View NZ_CP040173 Vibrio cholerae strain VC1374 Integron TA125036, TA125037, TA125038, TA125039, TA125040, TA125041, TA125042, TA125043, TA125044, TA125045, TA125046, TA125047, TA125048, TA125049, TA125050, TA125051, TA125052 887669..977464 0.005 View NZ_CP046841 Vibrio cholerae strain F9993 Integron TA145056, TA145057, TA145058, TA145059, TA145060, TA145061, TA145062, TA145063, TA145064, TA145065, TA145066, TA145067, TA145068, TA145069, TA145070, TA145071, TA145072 322432..412236 0.005 View NZ_CP047060 Vibrio cholerae isolate CTMA_1441 Integron TA145398, TA145399, TA145392, TA145393, TA145394, TA145395, TA145396, TA145397, TA145400, TA145401, TA145402, TA145403, TA145404, TA145405, TA145406, TA145407, TA145408, TA145409 311040..410783 0.004 View NZ_CP047296 Vibrio cholerae C6706 Integron TA145820, TA145815, TA145816, TA145817, TA145818, TA145819, TA145803, TA145804, TA145805, TA145806, TA145807, TA145808, TA145809, TA145810, TA145811, TA145812, TA145813, TA145814, TA145821 311985..435789 0 View NZ_CP047298 Vibrio cholerae O1 biovar El Tor strain C6709 Integron TA145823, TA145824, TA145825, TA145826, TA145827, TA145828, TA145829, TA145830, TA145831, TA145832, TA145833, TA145834, TA145835, TA145836, TA145837, TA145838, TA145839, TA145840, TA145841 311981..435786 0 View NZ_CP047300 Vibrio cholerae O1 biovar El Tor strain P27459 Integron TA145843, TA145844, TA145845, TA145846, TA145847, TA145848, TA145849, TA145850, TA145851, TA145852, TA145853, TA145854, TA145855, TA145856, TA145857, TA145858, TA145859, TA145860, TA145861 312006..438916 0 View NZ_CP047302 Vibrio cholerae O1 biovar El Tor strain DRC-193A Integron TA145864, TA145865, TA145866, TA145867, TA145868, TA145869, TA145870, TA145871, TA145872, TA145873, TA145874, TA145875, TA145876, TA145877, TA145878, TA145879, TA145880, TA145881 311015..410760 0.004 View NZ_CP047304 Vibrio cholerae O1 biovar El Tor strain E7946 Integron TA145883, TA145884, TA145885, TA145886, TA145887, TA145888, TA145889, TA145890, TA145891, TA145892, TA145893, TA145894, TA145895, TA145896, TA145897, TA145898, TA145899, TA145900, TA145901 312112..436375 0 View NZ_CP064351 Vibrio cholerae C6706 Integron TA180865, TA180866, TA180867, TA180868, TA180869, TA180870, TA180871, TA180872, TA180873, TA180874, TA180875, TA180876, TA180877, TA180878, TA180879, TA180880, TA180881, TA180882 378284..502088 0 View NZ_CP072848 Vibrio cholerae strain A1552 Integron TA198989, TA198978, TA198979, TA198980, TA198981, TA198982, TA198983, TA198984, TA198985, TA198986, TA198987, TA198988, TA198990, TA198991, TA198992, TA198993, TA198994 311994..435799 0 View NZ_CP072850 Vibrio cholerae MO10 Integron TA198998, TA198999, TA199000, TA199001, TA199002, TA199003, TA199004, TA199005, TA199006, TA199007, TA199008, TA199009, TA199010, TA199011, TA199012, TA199013 312008..401813 0.005 View NZ_CP080466 Vibrio cholerae strain ICDC-VC3741 Integron TA211906, TA211907, TA211908, TA211909, TA211910, TA211911, TA211912, TA211913, TA211914, TA211915, TA211916, TA211917, TA211918, TA211919, TA211920, TA211921, TA211922 933056..1032792 0.004 View NZ_CP090379 Vibrio cholerae strain BY369 Integron TA230515, TA230516, TA230517, TA230518, TA230519, TA230520, TA230521, TA230522, TA230523, TA230524, TA230525, TA230526, TA230527, TA230528, TA230529, TA230530 309725..399516 0.005 View NZ_CP090400 Vibrio cholerae strain PanChol Integron TA230635, TA230636, TA230637, TA230638, TA230639, TA230640, TA230641, TA230642, TA230643, TA230644, TA230645, TA230646, TA230647, TA230648, TA230649, TA230650, TA230651 836019..937068 0.004 View NZ_CP102928 Vibrio cholerae strain N1252 Integron TA254465, TA254466, TA254467, TA254468, TA254469, TA254470, TA254471, TA254472, TA254473, TA254474, TA254475, TA254476, TA254477, TA254478, TA254479, TA254480, TA254481 718932..819981 0.004 View NZ_LT906615 Vibrio cholerae O1 biovar El Tor str. N16961 Integron TA293792, TA293793, TA293794, TA293795, TA293796, TA293797, TA293798, TA293799, TA293800, TA293801, TA293802, TA293803, TA293804, TA293805, TA293806, TA293807, TA293808, TA293809 309746..435385 0 View NZ_LT907990 Vibrio cholerae strain A19 Integron TA293821, TA293822, TA293823, TA293824, TA293825, TA293826, TA293827, TA293828, TA293829, TA293830, TA293831, TA293832, TA293833, TA293834, TA293835, TA293836, TA293837, TA293838 309746..435385 0 View NZ_LT992487 Vibrio cholerae strain 4295STDY6534216 Integron TA294348, TA294349, TA294350, TA294351, TA294352, TA294353, TA294354, TA294355, TA294356, TA294357, TA294358, TA294359, TA294360, TA294361, TA294362, TA294363, TA294364 897901..987709 0.005 View NZ_LT992489 Vibrio cholerae strain 4295STDY6534232 Integron TA294368, TA294369, TA294370, TA294371, TA294372, TA294373, TA294374, TA294375, TA294376, TA294377, TA294378, TA294379, TA294380, TA294381, TA294382, TA294383, TA294384 379701..469509 0.005 View NZ_LT992493 Vibrio cholerae strain 4295STDY6534248 Integron TA294406, TA294407, TA294408, TA294409, TA294410, TA294411, TA294412, TA294413, TA294414, TA294415, TA294416, TA294417, TA294418, TA294419, TA294420, TA294421, TA294422 202848..292656 0.005 View NZ_OW443148 Vibrio cholerae strain CNRVC190243 isolate YE-NCPHL-19014-PI Integron TA295386, TA295387, TA295388, TA295389, TA295390, TA295391, TA295392, TA295393, TA295394, TA295395, TA295396, TA295397, TA295398, TA295399, TA295400, TA295401, TA295402 354985..456034 0.004	inside	Integron	catB9	-	309750..435387	125637

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Toxin-antitoxin system, RelE/ParE toxin family (5-84)

Antitoxin

• Type II toxin-antitoxin system, antitoxin Phd/YefM (11-71)

Sequences

Toxin

Protein

• Length: 96 a.a.
• Molecular weight: 10991.96 Da
• Isoelectric Point: 10.4934

>T175 WP_000221354.1 NC_002506:420241-420528 [Vibrio cholerae O1 biovar El Tor str. N16961]
MTYKLKFLPAAQKEWSKLAPTIQSQFKKKLKERLENPHVPSAKLRGYDAVYKIKLRTAGYRLAYEVIDDEIVVYVLAVGK
RDKDAVYKKLASRFG

Nucleotide

• Length: 288 bp

>T175 NC_002506:420241-420528 [Vibrio cholerae O1 biovar El Tor str. N16961]
ATGACCTATAAGTTAAAGTTTCTGCCGGCTGCGCAAAAGGAATGGAGTAAGTTAGCTCCGACAATTCAGAGTCAGTTCAA
GAAGAAGTTAAAGGAACGATTAGAAAATCCGCACGTCCCTTCGGCTAAGCTTCGAGGATACGACGCTGTTTACAAGATTA
AACTTCGTACGGCGGGTTATCGTTTAGCTTATGAGGTTATTGACGATGAGATAGTTGTCTATGTCCTTGCTGTCGGTAAA
CGTGACAAAGATGCTGTCTATAAAAAACTGGCTTCACGCTTCGGTTAG

Antitoxin

Protein

• Length: 84 a.a.
• Molecular weight: 9136.29 Da
• Isoelectric Point: 4.0197

>AT175 WP_001250179.1 NC_002506:420000-420251 [Vibrio cholerae O1 biovar El Tor str. N16961]
MRQVLANCSASISELKKNPTALLNEADGSAIAILNHNKPAAYLVPAETYEYLIDMLDDYELSQIVDSRRADLAQAVEVNI
DDL

Nucleotide

• Length: 252 bp

>AT175 NC_002506:420000-420251 [Vibrio cholerae O1 biovar El Tor str. N16961]
ATGAGACAAGTTTTAGCGAATTGCTCTGCAAGTATTTCAGAGTTAAAGAAGAACCCAACAGCTTTGTTGAATGAGGCTGA
TGGGTCTGCAATTGCAATTTTAAACCACAACAAGCCAGCGGCTTACCTTGTGCCAGCGGAAACGTATGAGTATCTCATCG
ATATGCTCGATGATTATGAGCTTTCCCAAATTGTCGATAGTCGCCGAGCTGACTTAGCACAAGCTGTGGAAGTAAATATT
GATGACCTATAA

Similar Proteins

Only experimentally validated proteins are listed.

Toxin

Loading, please wait

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
T173	Vibrio cholerae O1 biovar El Tor str. N16961	64.894	98.947	0.642
T10166	Xenorhabdus nematophila ATCC 19061	60.92	92.553	0.564
T6131	Escherichia coli	54.255	98.947	0.537
T6132	Escherichia coli	54.255	98.947	0.537
T6130	Erwinia pyrifoliae Ep1/96	53.191	98.947	0.526
T1041	Escherichia coli str. K-12 substr. MG1655	51.064	98.947	0.505
T6023	Xenorhabdus nematophila ATCC 19061	43.137	89.474	0.386
T10157	Streptococcus suis SC84	32.258	100	0.337

Showing 1 to 8 of 8 rows

10

rows per page

• ‹
• 1
• ›

Multiple sequence alignment

Antitoxin

Loading, please wait

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
AT173	Vibrio cholerae O1 biovar El Tor str. N16961	46.914	98.78	0.463
AT6130	Erwinia pyrifoliae Ep1/96	46.25	96.386	0.446
AT10166	Xenorhabdus nematophila ATCC 19061	43.21	97.59	0.422
AT6132	Escherichia coli	52.308	78.313	0.41
AT6131	Escherichia coli	52.308	78.313	0.41
AT6157	Escherichia coli str. K-12 substr. MG1655	36.765	81.928	0.301

Showing 1 to 6 of 6 rows

10

rows per page

• ‹
• 1
• ›

Multiple sequence alignment

Structures

Toxin

Loading, please wait

• AlphaFold DB: A0A0X1KZS6

Antitoxin

Loading, please wait

• AlphaFold DB: A0A0X1KZS8

References

(1) Naeem Iqbal et al. (2015) Comprehensive Functional Analysis of the 18 Vibrio cholerae N16961 Toxin-Antitoxin Systems Substantiates Their Role in Stabilizing the Superintegron. Journal of Bacteriology 197(13):2150-9. [PubMed:25897030]

(2) Evelyne Krin et al. (2023) Systematic transcriptome analysis allows the identification of new type I and type II Toxin/Antitoxin systems located in the superintegron of Vibrio cholerae. Research in Microbiology 174(1-2):103997. [PubMed:36347445]


 experimental literature