254477

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) /GNAT-DUF1778
Location 806381..807147 Replicon chromosome
Accession NZ_CP102928
Organism Vibrio cholerae strain N1252

Toxin (Protein)


Gene name - Uniprot ID Q9K2P7
Locus tag NW313_RS17875 Protein ID WP_000982260.1
Coordinates 806381..806878 (-) Length 166 a.a.

Antitoxin (Protein)


Gene name - Uniprot ID Q9K2J6
Locus tag NW313_RS17880 Protein ID WP_000246253.1
Coordinates 806875..807147 (-) Length 91 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NW313_RS17815 802243..802549 + 307 Protein_786 CatB-related O-acetyltransferase -
NW313_RS17820 802686..803084 + 399 Protein_787 GNAT family N-acetyltransferase -
NW313_RS17825 803208..803378 + 171 WP_001080654.1 hypothetical protein -
NW313_RS17830 803378..803779 + 402 WP_000351248.1 type II toxin-antitoxin system death-on-curing family toxin -
NW313_RS17835 803782..803892 + 111 WP_082798255.1 DUF3265 domain-containing protein -
NW313_RS17840 803967..804380 + 414 WP_000049417.1 VOC family protein -
NW313_RS17845 804594..804845 + 252 WP_001250179.1 type II toxin-antitoxin system Phd/YefM family antitoxin -
NW313_RS17850 804835..805122 + 288 WP_000221354.1 type II toxin-antitoxin system RelE/ParE family toxin -
NW313_RS17855 805250..805705 + 456 WP_001245327.1 GNAT family N-acetyltransferase -
NW313_RS17860 805762..805884 + 123 Protein_795 acetyltransferase -
NW313_RS17865 806055..806179 + 125 Protein_796 DUF645 family protein -
NW313_RS17870 806296..806364 + 69 Protein_797 acetyltransferase -
NW313_RS17875 806381..806878 - 498 WP_000982260.1 GNAT family N-acetyltransferase Toxin
NW313_RS17880 806875..807147 - 273 WP_000246253.1 DUF1778 domain-containing protein Antitoxin
NW313_RS17885 807299..807361 + 63 Protein_800 acetyltransferase -
NW313_RS17890 807378..808046 + 669 WP_000043871.1 hypothetical protein -
NW313_RS17895 808198..808485 + 288 WP_000426470.1 hypothetical protein -
NW313_RS17900 808626..808997 + 372 WP_001164080.1 MazG nucleotide pyrophosphohydrolase domain-containing protein -
NW313_RS17905 809220..809489 + 270 WP_000179600.1 DUF1778 domain-containing protein -
NW313_RS17910 809486..810019 + 534 WP_000118351.1 GNAT family N-acetyltransferase -
NW313_RS17915 810029..810139 + 111 WP_086010065.1 DUF3265 domain-containing protein -
NW313_RS17920 810221..810478 + 258 WP_000861987.1 type II toxin-antitoxin system Phd/YefM family antitoxin -
NW313_RS17925 810466..810768 + 303 WP_000229317.1 type II toxin-antitoxin system RelE/ParE family toxin -
NW313_RS17930 811002..811919 + 918 WP_000186333.1 alpha/beta hydrolase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Genomic island catB9 - 713852..820357 106505
inside Integron catB9 - 718932..819981 101049
flank IS/Tn - - 801195..802175 980


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

GNAT domain

(86-152)

Antitoxin

Vibrio phage ICP1, Orf50

(7-86)


Sequences

Toxin        


Download         Length: 166 a.a.        Molecular weight: 18527.18 Da        Isoelectric Point: 8.7753

>T254477 WP_000982260.1 NZ_CP102928:c806878-806381 [Vibrio cholerae]
MMNTVLLDKDKHDRNRFNCGTEALNNYLKVMASQQAKKDNTRTFVLEDDNNSAYIIGFYTLTMTPIDLKALPDKLQKKHQ
SSTSGGLIARLAVDDRYKGKGFGEWLLIDALRKLLAASDSVAFPVVIVDAKDGAKHFYERYGFQAFQDAENKLFITIADI
RASLG

Download         Length: 498 bp

Antitoxin


Download         Length: 91 a.a.        Molecular weight: 9683.22 Da        Isoelectric Point: 6.2988

>AT254477 WP_000246253.1 NZ_CP102928:c807147-806875 [Vibrio cholerae]
MATTLPRITARVDVDTQDLLAKAAALAGMSSINSFVLNAAIEKAKQVIEREQALKLSQADAVLLMEALDNPAVVNAKLKL
ASERYESKTQ

Download         Length: 273 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0Q0KGB1

Antitoxin

Source ID Structure
AlphaFold DB A0A0F2IC79

References