Detailed information of TA system TA000179

Experimentally validated

Overview

TA module

• Type: II
• Classification (family/domain): relBE/-
• Location: 433035..433678
• Replicon: chromosome II
• Accession: NC_002506
• Organism: Vibrio cholerae O1 biovar El Tor str. N16961

Toxin (Protein)

• Gene name: relE
• Uniprot ID: Q9K2M8
• Locus tag: VC_RS15830
• Protein ID: WP_000578476.1
• Coordinates: 433035..433313 (-)
• Length: 93 a.a.

Antitoxin (Protein)

• Gene name: relB
• Uniprot ID: Q9L991
• Locus tag: VC_RS15835
• Protein ID: WP_000381183.1
• Coordinates: 433310..433594 (-)
• Length: 95 a.a.

Genomic Context

Location: 428335..428772 (438 bp)
Type: Others
Protein ID: WP_000503169.1

Location: 428836..429054 (219 bp)
Type: Others
Protein ID: WP_071908318.1

Location: 429229..430101 (873 bp)
Type: Others
Protein ID: WP_000254716.1

Location: 430251..430850 (600 bp)
Type: Others
Protein ID: WP_001891245.1

Location: 430907..431011 (105 bp)
Type: Others
Protein ID: WP_099607150.1

Location: 431042..431311 (270 bp)
Type: Others
Protein ID: WP_001114075.1

Location: 431305..431826 (522 bp)
Type: Others
Protein ID: WP_000921691.1

Location: 432125..432250 (126 bp)
Type: Others
Protein ID: WP_001905700.1

Location: 432501..432896 (396 bp)
Type: Others
Protein ID: WP_001000867.1

Location: 433788..434303 (516 bp)
Type: Others
Protein ID: WP_000343779.1

Location: 434487..434900 (414 bp)
Type: Others
Protein ID: WP_000049420.1

Location: 435455..436632 (1178 bp)
Type: Others
Protein ID: WP_086010879.1

Location: 433035..433313 (279 bp)
Type: Toxin
Protein ID: WP_000578476.1

Location: 433310..433594 (285 bp)
Type: Antitoxin
Protein ID: WP_000381183.1

Loading, please wait

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
VC_RS15785 (VC_A0493)	428335..428772	+	438	WP_000503169.1	IS200/IS605-like element IS1004 family transposase	-
VC_RS15790 (VC_A0494)	428836..429054	+	219	WP_071908318.1	GNAT family N-acetyltransferase	-
VC_RS15795 (VC_A0495)	429229..430101	+	873	WP_000254716.1	DUF3800 domain-containing protein	-
VC_RS15800 (VC_A0496)	430251..430850	+	600	WP_001891245.1	glutathione S-transferase N-terminal domain-containing protein	-
VC_RS15805	430907..431011	+	105	WP_099607150.1	acetyltransferase	-
VC_RS15810 (VC_A0497)	431042..431311	+	270	WP_001114075.1	DUF4160 domain-containing protein	-
VC_RS15815 (VC_A0498)	431305..431826	+	522	WP_000921691.1	DUF2442 domain-containing protein	-
VC_RS15820	432125..432250	+	126	WP_001905700.1	DUF645 family protein	-
VC_RS15825 (VC_A0501)	432501..432896	+	396	WP_001000867.1	hypothetical protein	-
VC_RS15830 (VC_A0503)	433035..433313	-	279	WP_000578476.1	type II toxin-antitoxin system mRNA interferase toxin, RelE/StbE family	Toxin
VC_RS15835 (VC_A0504)	433310..433594	-	285	WP_000381183.1	type II toxin-antitoxin system RelB/DinJ family antitoxin	Antitoxin
VC_RS15840 (VC_A0505)	433788..434303	+	516	WP_000343779.1	GNAT family N-acetyltransferase	-
VC_RS15845 (VC_A0506)	434487..434900	+	414	WP_000049420.1	VOC family protein	-
VC_RS15855 (VC_A0508)	435455..436632	+	1178	WP_086010879.1	IS3-like element ISVch4 family transposase	-

Associated MGEs

Loading, please wait

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)
	Similar MGE(s) Similar MGE(s) is defined as other TA-related MGE(s) with Mash distance < 0.01 to this MGE. Detail Genome accession Organism MGE type Related TA Coordinates Mash distance View NC_009456 Vibrio cholerae O395 IS/Tn TA022069, TA022070, TA022071, TA022072, TA022073 806473..806910 0.002 View NC_012580 Vibrio cholerae M66-2 IS/Tn TA023716, TA023717, TA023718, TA023719, TA023720, TA023721 402350..402787 0 View NC_012583 Vibrio cholerae O395 IS/Tn TA023736, TA023737, TA023738, TA023739, TA023740 457032..457469 0.002 View NC_012667 Vibrio cholerae MJ-1236 IS/Tn TA023778, TA023779, TA023780 938381..938818 0 View NC_016446 Vibrio cholerae O1 str. 2010EL-1786 IS/Tn TA025718, TA025719, TA025720, TA025721, TA025722 128876..129313 0 View NC_016945 Vibrio cholerae IEC224 IS/Tn TA026156, TA026157, TA026158, TA026159, TA026160 428154..428591 0 View NZ_AP014525 Vibrio cholerae MS6 IS/Tn TA030647, TA030648, TA030649, TA030650, TA030651 438153..438590 0.002 View NZ_AP018677 Vibrio cholerae strain V060002 IS/Tn TA031949, TA031950, TA031951, TA031952, TA031953 1518353..1518790 0 View NZ_AP024548 Vibrio cholerae strain BCH-01536 IS/Tn TA038629, TA038630, TA038631, TA038632 106596..107033 0 View NZ_AP024548 Vibrio cholerae strain BCH-01536 IS/Tn TA038625 88179..88598 0.008 View NZ_AP024550 Vibrio cholerae strain IDH-00113 IS/Tn TA038646, TA038647, TA038648 881185..881622 0 View NZ_AP024552 Vibrio cholerae strain IDH-02387 IS/Tn TA038650, TA038651, TA038652, TA038653 679393..679830 0 View NZ_AP024554 Vibrio cholerae strain IDH-03329 IS/Tn TA038668, TA038669, TA038670, TA038671 219734..220171 0 View NZ_AP024556 Vibrio cholerae strain IDH-03506 IS/Tn TA038698, TA038699, TA038700 80684..81121 0 View NZ_CP006948 Vibrio cholerae O1 str. KW3 IS/Tn TA045815, TA045816, TA045817, TA045818, TA045819 403709..404146 0 View NZ_CP007635 Vibrio cholerae strain 2012EL-2176 IS/Tn TA046762, TA046763, TA046764, TA046765, TA046766 130114..130551 0 View NZ_CP009041 Vibrio cholerae O1 biovar El Tor strain FJ147 IS/Tn TA048158, TA048159, TA048160, TA048161, TA048162 402464..402901 0 View NZ_CP012666 Vibrio cholerae strain ICDC-VC661 IS/Tn TA056921, TA056922, TA056923, TA056924, TA056925 392464..392901 0 View NZ_CP012997 Vibrio cholerae strain 2012Env-9 IS/Tn TA057653, TA057654, TA057655, TA057656, TA057657 835116..835553 0 View NZ_CP013013 Vibrio cholerae strain Env-390 IS/Tn TA057700, TA057701, TA057702, TA057703, TA057704 836314..836751 0 View NZ_CP013302 Vibrio cholerae strain C5 IS/Tn TA058231, TA058232, TA058233, TA058234, TA058235 461858..462295 0 View NZ_CP013304 Vibrio cholerae strain CRC711 IS/Tn TA058252, TA058253, TA058254, TA058255, TA058256 420246..420683 0 View NZ_CP013306 Vibrio cholerae strain CRC1106 IS/Tn TA058276, TA058277, TA058278, TA058279, TA058280 456123..456560 0 View NZ_CP013310 Vibrio cholerae strain E1162 IS/Tn TA058319, TA058320, TA058321, TA058322, TA058323 589231..589668 0 View NZ_CP013312 Vibrio cholerae strain E1320 IS/Tn TA058337 811607..812044 0.005 View NZ_CP013312 Vibrio cholerae strain E1320 IS/Tn TA058342, TA058343, TA058344, TA058345, TA058346 836106..836543 0 View NZ_CP013314 Vibrio cholerae strain E9120 IS/Tn TA058366, TA058367, TA058368, TA058369, TA058370 461036..461473 0 View NZ_CP013316 Vibrio cholerae strain M2140 IS/Tn TA058385, TA058386, TA058387, TA058388, TA058389 214542..214979 0.002 View NZ_CP013318 Vibrio cholerae strain NCTC5395 IS/Tn TA058407, TA058408, TA058409, TA058410, TA058411 489405..489842 0 View NZ_CP013320 Vibrio cholerae strain NCTC9420 IS/Tn TA058428, TA058429, TA058430, TA058431, TA058432 428810..429247 0 View NZ_CP020407 Vibrio cholerae strain FDAARGOS_223 IS/Tn TA074614, TA074615, TA074616, TA074617, TA074618 756078..756515 0 View NZ_CP024163 Vibrio cholerae strain E7946 IS/Tn TA087029, TA087030, TA087031, TA087032, TA087033 426516..426953 0 View NZ_CP024868 Vibrio cholerae strain A1552 IS/Tn TA089000, TA089001, TA089002, TA089003, TA089004 426550..426987 0 View NZ_CP025937 Vibrio cholerae strain A1552 IS/Tn TA092515, TA092516, TA092517, TA092518, TA092519 425900..426337 0 View NZ_CP026648 Vibrio cholerae O1 biovar El Tor strain HC1037 IS/Tn TA095391, TA095388, TA095389, TA095390, TA095392 128806..129243 0 View NZ_CP028828 Vibrio cholerae strain N16961 IS/Tn TA104260, TA104261, TA104262, TA104263, TA104264 430645..431082 0 View NZ_CP028895 Vibrio cholerae strain A1552 IS/Tn TA104348, TA104349, TA104350, TA104351, TA104352 428747..429184 0 View NZ_CP033513 Vibrio cholerae strain E4 IS/Tn TA113794, TA113795, TA113796, TA113797, TA113798 133754..134191 0 View NZ_CP036500 Vibrio cholerae strain 20000 IS/Tn TA119900, TA119901 378304..378741 0.005 View NZ_CP040173 Vibrio cholerae strain VC1374 IS/Tn TA125048, TA125049, TA125050, TA125051, TA125052 970413..970850 0 View NZ_CP042300 Vibrio cholerae O1 strain AAS91 IS/Tn TA135192, TA135193, TA135194, TA135195, TA135196 835109..835546 0 View NZ_CP043556 Vibrio cholerae strain RFB16 IS/Tn TA139009 1065827..1066264 0.005 View NZ_CP045718 Vibrio cholerae O395 substr. TCP2 IS/Tn TA142367, TA142368, TA142369, TA142370, TA142371 806022..806459 0.002 View NZ_CP046841 Vibrio cholerae strain F9993 IS/Tn TA145056, TA145057, TA145058, TA145059, TA145060 329047..329484 0 View NZ_CP046845 Vibrio cholerae C6706 IS/Tn TA145074, TA145075, TA145076, TA145077, TA145078 5644..6081 0 View NZ_CP047060 Vibrio cholerae isolate CTMA_1441 IS/Tn TA145405, TA145406, TA145407, TA145408, TA145409 403731..404168 0.002 View NZ_CP047296 Vibrio cholerae C6706 IS/Tn TA145819, TA145817, TA145818, TA145820, TA145821 428737..429174 0 View NZ_CP047298 Vibrio cholerae O1 biovar El Tor strain C6709 IS/Tn TA145837, TA145838, TA145839, TA145840, TA145841 428734..429171 0 View NZ_CP047300 Vibrio cholerae O1 biovar El Tor strain P27459 IS/Tn TA145857, TA145858, TA145859, TA145860, TA145861 431864..432301 0 View NZ_CP047302 Vibrio cholerae O1 biovar El Tor strain DRC-193A IS/Tn TA145877, TA145878, TA145879, TA145880, TA145881 403708..404145 0 View NZ_CP047304 Vibrio cholerae O1 biovar El Tor strain E7946 IS/Tn TA145897, TA145898, TA145899, TA145900, TA145901 429323..429760 0 View NZ_CP047306 Vibrio cholerae O37 strain ATCC 25872 IS/Tn TA145915, TA145916, TA145917, TA145918 426296..426733 0 View NZ_CP053803 Vibrio cholerae strain L6G IS/Tn TA157924, TA157925 384484..384921 0.005 View NZ_CP053807 Vibrio cholerae strain SP6G IS/Tn TA157970, TA157971 702297..702734 0.007 View NZ_CP064351 Vibrio cholerae C6706 IS/Tn TA180878, TA180879, TA180880, TA180881, TA180882 495036..495473 0 View NZ_CP072848 Vibrio cholerae strain A1552 IS/Tn TA198991, TA198992, TA198993, TA198994 428747..429184 0 View NZ_CP072850 Vibrio cholerae MO10 IS/Tn TA199010, TA199011, TA199012, TA199013 394761..395198 0 View NZ_CP077061 Vibrio cholerae strain MS84A IS/Tn TA206614, TA206615 1043033..1043470 0 View NZ_CP080466 Vibrio cholerae strain ICDC-VC3741 IS/Tn TA211906, TA211907, TA211908, TA211909 939671..940108 0 View NZ_CP090379 Vibrio cholerae strain BY369 IS/Tn TA230527, TA230528, TA230529, TA230530 392464..392901 0 View NZ_CP090400 Vibrio cholerae strain PanChol IS/Tn TA230635, TA230636, TA230637, TA230638 842634..843071 0.002 View NZ_CP102928 Vibrio cholerae strain N1252 IS/Tn TA254478, TA254479, TA254480, TA254481 812929..813366 0.002 View NZ_LT906615 Vibrio cholerae O1 biovar El Tor str. N16961 IS/Tn TA293805, TA293806, TA293807, TA293808, TA293809 428333..428770 0 View NZ_LT907990 Vibrio cholerae strain A19 IS/Tn TA293834, TA293835, TA293836, TA293837, TA293838 428333..428770 0 View NZ_LT992487 Vibrio cholerae strain 4295STDY6534216 IS/Tn TA294348, TA294349, TA294350, TA294351, TA294352 904516..904953 0 View NZ_LT992489 Vibrio cholerae strain 4295STDY6534232 IS/Tn TA294368, TA294369, TA294370, TA294371, TA294372 386316..386753 0 View NZ_LT992493 Vibrio cholerae strain 4295STDY6534248 IS/Tn TA294418, TA294419, TA294420, TA294421, TA294422 285604..286041 0 View NZ_OW443148 Vibrio cholerae strain CNRVC190243 isolate YE-NCPHL-19014-PI IS/Tn TA295399, TA295400, TA295401, TA295402 448982..449419 0 View NZ_OW443150 Vibrio cholerae strain CNRVC190247 isolate YE-NCPHL-18035-PI IS/Tn TA295404 170840..171277 0.005	flank	IS/Tn	-	-	428335..428772	437
	Similar MGE(s) Similar MGE(s) is defined as other TA-related MGE(s) with Mash distance < 0.01 to this MGE. Detail Genome accession Organism MGE type Related TA Coordinates Mash distance View NC_012667 Vibrio cholerae MJ-1236 Integron TA023781, TA023782, TA023783, TA023784, TA023785, TA023786, TA023787, TA023788, TA023789, TA023790, TA023791, TA023792, TA023793, TA023794, TA023795 958376..1050596 0.006 View NC_016446 Vibrio cholerae O1 str. 2010EL-1786 Integron TA025705, TA025706, TA025707, TA025708, TA025709, TA025710, TA025711, TA025712, TA025713, TA025714, TA025715, TA025716, TA025717, TA025718, TA025719, TA025720, TA025721, TA025722 36195..135928 0.004 View NC_016945 Vibrio cholerae IEC224 Integron TA026143, TA026144, TA026145, TA026146, TA026147, TA026148, TA026149, TA026150, TA026151, TA026152, TA026153, TA026154, TA026155, TA026156, TA026157, TA026158, TA026159, TA026160 309717..435206 0 View NZ_AP024548 Vibrio cholerae strain BCH-01536 Integron TA038617, TA038618, TA038619, TA038620, TA038621, TA038622, TA038623, TA038624, TA038625, TA038626, TA038627, TA038628, TA038629, TA038630, TA038631, TA038632 11978..113648 0.004 View NZ_AP024554 Vibrio cholerae strain IDH-03329 Integron TA038668, TA038669, TA038670, TA038671, TA038672, TA038673, TA038674, TA038675, TA038676, TA038677, TA038678, TA038679, TA038680, TA038681, TA038682, TA038683, TA038684 213119..312856 0.004 View NZ_CP006948 Vibrio cholerae O1 str. KW3 Integron TA045802, TA045803, TA045804, TA045805, TA045806, TA045807, TA045808, TA045809, TA045810, TA045811, TA045812, TA045813, TA045814, TA045815, TA045816, TA045817, TA045818, TA045819 309725..410760 0.004 View NZ_CP007635 Vibrio cholerae strain 2012EL-2176 Integron TA046749, TA046750, TA046751, TA046752, TA046753, TA046754, TA046755, TA046756, TA046757, TA046758, TA046759, TA046760, TA046761, TA046762, TA046763, TA046764, TA046765, TA046766 36117..137166 0.004 View NZ_CP009041 Vibrio cholerae O1 biovar El Tor strain FJ147 Integron TA048145, TA048146, TA048147, TA048148, TA048149, TA048150, TA048151, TA048152, TA048153, TA048154, TA048155, TA048156, TA048157, TA048158, TA048159, TA048160, TA048161, TA048162 309780..409516 0.004 View NZ_CP012666 Vibrio cholerae strain ICDC-VC661 Integron TA056924, TA056909, TA056910, TA056911, TA056912, TA056913, TA056914, TA056915, TA056916, TA056917, TA056918, TA056919, TA056920, TA056921, TA056922, TA056923, TA056925 309725..399516 0.005 View NZ_CP013302 Vibrio cholerae strain C5 Integron TA058213, TA058214, TA058215, TA058216, TA058217, TA058218, TA058219, TA058220, TA058221, TA058222, TA058223, TA058224, TA058225, TA058226, TA058227, TA058228, TA058229, TA058230, TA058231, TA058232, TA058233, TA058234, TA058235 309774..468910 0.005 View NZ_CP013306 Vibrio cholerae strain CRC1106 Integron TA058258, TA058259, TA058260, TA058261, TA058262, TA058263, TA058264, TA058265, TA058266, TA058267, TA058268, TA058269, TA058270, TA058271, TA058272, TA058273, TA058274, TA058275, TA058276, TA058277, TA058278, TA058279, TA058280 309821..463174 0.006 View NZ_CP013310 Vibrio cholerae strain E1162 Integron TA058301, TA058302, TA058303, TA058304, TA058305, TA058306, TA058307, TA058308, TA058309, TA058310, TA058311, TA058312, TA058313, TA058314, TA058315, TA058316, TA058317, TA058318, TA058319, TA058320, TA058321, TA058322, TA058323 440614..596283 0.005 View NZ_CP013314 Vibrio cholerae strain E9120 Integron TA058348, TA058349, TA058350, TA058351, TA058352, TA058353, TA058354, TA058355, TA058356, TA058357, TA058358, TA058359, TA058360, TA058361, TA058362, TA058363, TA058364, TA058365, TA058366, TA058367, TA058368, TA058369, TA058370 309780..468088 0.005 View NZ_CP013316 Vibrio cholerae strain M2140 Integron TA058372, TA058373, TA058374, TA058375, TA058376, TA058377, TA058378, TA058379, TA058380, TA058381, TA058382, TA058383, TA058384, TA058385, TA058386, TA058387, TA058388, TA058389 93061..221594 0.008 View NZ_CP013318 Vibrio cholerae strain NCTC5395 Integron TA058391, TA058392, TA058393, TA058394, TA058395, TA058396, TA058397, TA058398, TA058399, TA058400, TA058401, TA058402, TA058403, TA058404, TA058405, TA058406, TA058407, TA058408, TA058409, TA058410, TA058411 343365..496457 0.009 View NZ_CP020407 Vibrio cholerae strain FDAARGOS_223 Integron TA074614, TA074615, TA074616, TA074617, TA074618, TA074619, TA074620, TA074621, TA074622, TA074623, TA074624, TA074625, TA074626, TA074627, TA074628, TA074629, TA074630, TA074631 749463..875103 0 View NZ_CP024163 Vibrio cholerae strain E7946 Integron TA087016, TA087017, TA087018, TA087019, TA087020, TA087021, TA087022, TA087023, TA087024, TA087025, TA087026, TA087027, TA087028, TA087029, TA087030, TA087031, TA087032, TA087033 309306..433568 0 View NZ_CP024868 Vibrio cholerae strain A1552 Integron TA088996, TA088997, TA088987, TA088988, TA088989, TA088990, TA088991, TA088992, TA088993, TA088994, TA088995, TA088998, TA088999, TA089000, TA089001, TA089002, TA089003, TA089004 309797..433602 0 View NZ_CP025937 Vibrio cholerae strain A1552 Integron TA092502, TA092503, TA092504, TA092505, TA092506, TA092507, TA092508, TA092509, TA092510, TA092511, TA092512, TA092513, TA092514, TA092515, TA092516, TA092517, TA092518, TA092519 309147..432952 0 View NZ_CP026648 Vibrio cholerae O1 biovar El Tor strain HC1037 Integron TA095391, TA095375, TA095376, TA095377, TA095378, TA095379, TA095380, TA095381, TA095382, TA095383, TA095384, TA095385, TA095386, TA095387, TA095388, TA095389, TA095390, TA095392 36123..135858 0.004 View NZ_CP028828 Vibrio cholerae strain N16961 Integron TA104260, TA104261, TA104247, TA104248, TA104249, TA104250, TA104251, TA104252, TA104253, TA104254, TA104255, TA104256, TA104257, TA104258, TA104259, TA104262, TA104263, TA104264 312057..437697 0 View NZ_CP028895 Vibrio cholerae strain A1552 Integron TA104335, TA104336, TA104337, TA104338, TA104339, TA104340, TA104341, TA104342, TA104343, TA104344, TA104345, TA104346, TA104347, TA104348, TA104349, TA104350, TA104351, TA104352 311994..435799 0 View NZ_CP033513 Vibrio cholerae strain E4 Integron TA113805, TA113806, TA113807, TA113808, TA113794, TA113795, TA113796, TA113797, TA113798, TA113799, TA113800, TA113801, TA113802, TA113803, TA113804, TA113809, TA113810, TA113811 127139..226875 0.004 View NZ_CP040173 Vibrio cholerae strain VC1374 Integron TA125036, TA125037, TA125038, TA125039, TA125040, TA125041, TA125042, TA125043, TA125044, TA125045, TA125046, TA125047, TA125048, TA125049, TA125050, TA125051, TA125052 887669..977464 0.005 View NZ_CP046841 Vibrio cholerae strain F9993 Integron TA145056, TA145057, TA145058, TA145059, TA145060, TA145061, TA145062, TA145063, TA145064, TA145065, TA145066, TA145067, TA145068, TA145069, TA145070, TA145071, TA145072 322432..412236 0.005 View NZ_CP047060 Vibrio cholerae isolate CTMA_1441 Integron TA145398, TA145399, TA145392, TA145393, TA145394, TA145395, TA145396, TA145397, TA145400, TA145401, TA145402, TA145403, TA145404, TA145405, TA145406, TA145407, TA145408, TA145409 311040..410783 0.004 View NZ_CP047296 Vibrio cholerae C6706 Integron TA145820, TA145815, TA145816, TA145817, TA145818, TA145819, TA145803, TA145804, TA145805, TA145806, TA145807, TA145808, TA145809, TA145810, TA145811, TA145812, TA145813, TA145814, TA145821 311985..435789 0 View NZ_CP047298 Vibrio cholerae O1 biovar El Tor strain C6709 Integron TA145823, TA145824, TA145825, TA145826, TA145827, TA145828, TA145829, TA145830, TA145831, TA145832, TA145833, TA145834, TA145835, TA145836, TA145837, TA145838, TA145839, TA145840, TA145841 311981..435786 0 View NZ_CP047300 Vibrio cholerae O1 biovar El Tor strain P27459 Integron TA145843, TA145844, TA145845, TA145846, TA145847, TA145848, TA145849, TA145850, TA145851, TA145852, TA145853, TA145854, TA145855, TA145856, TA145857, TA145858, TA145859, TA145860, TA145861 312006..438916 0 View NZ_CP047302 Vibrio cholerae O1 biovar El Tor strain DRC-193A Integron TA145864, TA145865, TA145866, TA145867, TA145868, TA145869, TA145870, TA145871, TA145872, TA145873, TA145874, TA145875, TA145876, TA145877, TA145878, TA145879, TA145880, TA145881 311015..410760 0.004 View NZ_CP047304 Vibrio cholerae O1 biovar El Tor strain E7946 Integron TA145883, TA145884, TA145885, TA145886, TA145887, TA145888, TA145889, TA145890, TA145891, TA145892, TA145893, TA145894, TA145895, TA145896, TA145897, TA145898, TA145899, TA145900, TA145901 312112..436375 0 View NZ_CP064351 Vibrio cholerae C6706 Integron TA180865, TA180866, TA180867, TA180868, TA180869, TA180870, TA180871, TA180872, TA180873, TA180874, TA180875, TA180876, TA180877, TA180878, TA180879, TA180880, TA180881, TA180882 378284..502088 0 View NZ_CP072848 Vibrio cholerae strain A1552 Integron TA198989, TA198978, TA198979, TA198980, TA198981, TA198982, TA198983, TA198984, TA198985, TA198986, TA198987, TA198988, TA198990, TA198991, TA198992, TA198993, TA198994 311994..435799 0 View NZ_CP072850 Vibrio cholerae MO10 Integron TA198998, TA198999, TA199000, TA199001, TA199002, TA199003, TA199004, TA199005, TA199006, TA199007, TA199008, TA199009, TA199010, TA199011, TA199012, TA199013 312008..401813 0.005 View NZ_CP080466 Vibrio cholerae strain ICDC-VC3741 Integron TA211906, TA211907, TA211908, TA211909, TA211910, TA211911, TA211912, TA211913, TA211914, TA211915, TA211916, TA211917, TA211918, TA211919, TA211920, TA211921, TA211922 933056..1032792 0.004 View NZ_CP090379 Vibrio cholerae strain BY369 Integron TA230515, TA230516, TA230517, TA230518, TA230519, TA230520, TA230521, TA230522, TA230523, TA230524, TA230525, TA230526, TA230527, TA230528, TA230529, TA230530 309725..399516 0.005 View NZ_CP090400 Vibrio cholerae strain PanChol Integron TA230635, TA230636, TA230637, TA230638, TA230639, TA230640, TA230641, TA230642, TA230643, TA230644, TA230645, TA230646, TA230647, TA230648, TA230649, TA230650, TA230651 836019..937068 0.004 View NZ_CP102928 Vibrio cholerae strain N1252 Integron TA254465, TA254466, TA254467, TA254468, TA254469, TA254470, TA254471, TA254472, TA254473, TA254474, TA254475, TA254476, TA254477, TA254478, TA254479, TA254480, TA254481 718932..819981 0.004 View NZ_LT906615 Vibrio cholerae O1 biovar El Tor str. N16961 Integron TA293792, TA293793, TA293794, TA293795, TA293796, TA293797, TA293798, TA293799, TA293800, TA293801, TA293802, TA293803, TA293804, TA293805, TA293806, TA293807, TA293808, TA293809 309746..435385 0 View NZ_LT907990 Vibrio cholerae strain A19 Integron TA293821, TA293822, TA293823, TA293824, TA293825, TA293826, TA293827, TA293828, TA293829, TA293830, TA293831, TA293832, TA293833, TA293834, TA293835, TA293836, TA293837, TA293838 309746..435385 0 View NZ_LT992487 Vibrio cholerae strain 4295STDY6534216 Integron TA294348, TA294349, TA294350, TA294351, TA294352, TA294353, TA294354, TA294355, TA294356, TA294357, TA294358, TA294359, TA294360, TA294361, TA294362, TA294363, TA294364 897901..987709 0.005 View NZ_LT992489 Vibrio cholerae strain 4295STDY6534232 Integron TA294368, TA294369, TA294370, TA294371, TA294372, TA294373, TA294374, TA294375, TA294376, TA294377, TA294378, TA294379, TA294380, TA294381, TA294382, TA294383, TA294384 379701..469509 0.005 View NZ_LT992493 Vibrio cholerae strain 4295STDY6534248 Integron TA294406, TA294407, TA294408, TA294409, TA294410, TA294411, TA294412, TA294413, TA294414, TA294415, TA294416, TA294417, TA294418, TA294419, TA294420, TA294421, TA294422 202848..292656 0.005 View NZ_OW443148 Vibrio cholerae strain CNRVC190243 isolate YE-NCPHL-19014-PI Integron TA295386, TA295387, TA295388, TA295389, TA295390, TA295391, TA295392, TA295393, TA295394, TA295395, TA295396, TA295397, TA295398, TA295399, TA295400, TA295401, TA295402 354985..456034 0.004	inside	Integron	catB9	-	309750..435387	125637

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Toxin-antitoxin system, RelE/ParE toxin family (2-89)

Antitoxin

• RelB antitoxin/Antitoxin DinJ (5-70)

Sequences

Toxin

Protein

• Length: 93 a.a.
• Molecular weight: 10819.59 Da
• Isoelectric Point: 5.1651

>T179 WP_000578476.1 NC_002506:c433313-433035 [Vibrio cholerae O1 biovar El Tor str. N16961]
MIFWEEASLNDREKIFEFLYDFNPAAAKKTDELIEAKVENLLEQPLIGVQRDGIRGRLLIIPEISMIVSYWVDGSKIRIM
RVLHQKQKFPND

Nucleotide

• Length: 279 bp

>T179 NC_002506:c433313-433035 [Vibrio cholerae O1 biovar El Tor str. N16961]
ATGATTTTCTGGGAAGAAGCATCTCTCAATGATCGTGAGAAAATTTTCGAATTTCTCTACGACTTTAACCCAGCAGCGGC
TAAAAAAACGGATGAGCTCATAGAAGCCAAAGTCGAAAATTTGCTTGAGCAACCACTAATCGGTGTTCAGCGTGATGGCA
TTAGAGGCAGATTGCTTATTATCCCTGAGATATCAATGATTGTTTCGTATTGGGTTGATGGTTCTAAAATTCGAATAATG
CGTGTACTACATCAGAAACAAAAATTTCCAAACGACTGA

Antitoxin

Protein

• Length: 95 a.a.
• Molecular weight: 10901.25 Da
• Isoelectric Point: 8.0775

>AT179 WP_000381183.1 NC_002506:c433594-433310 [Vibrio cholerae O1 biovar El Tor str. N16961]
MDTRIQFRVDEETKRLAQQMAESQGRTLSDACRELTEQLAEQQRKALSHDAWLTEQVNQAFEKFDSGKAVFIEHDIAKAR
MAERKAKIRNRGHA

Nucleotide

• Length: 285 bp

>AT179 NC_002506:c433594-433310 [Vibrio cholerae O1 biovar El Tor str. N16961]
ATGGATACTAGAATTCAATTTCGTGTAGACGAAGAAACAAAACGTTTAGCTCAACAAATGGCTGAAAGCCAAGGTCGAAC
TCTTAGCGATGCTTGCCGTGAACTCACTGAACAATTAGCTGAGCAGCAACGCAAGGCATTATCTCACGATGCATGGCTAA
CTGAACAAGTGAATCAAGCATTTGAGAAGTTCGACTCAGGAAAAGCAGTATTCATTGAACATGACATCGCCAAAGCACGA
ATGGCTGAACGTAAAGCTAAAATCCGAAATCGAGGCCACGCATGA

Similar Proteins

Only experimentally validated proteins are listed.

Toxin

Loading, please wait

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
T168	Vibrio cholerae O1 biovar El Tor str. N16961	100	100	1
T705	Vibrio parahaemolyticus RIMD 2210633	84.783	100	0.848
T6097	Sinorhizobium meliloti 1021	38.462	98.913	0.38
T10119	Escherichia coli	34.783	100	0.348

Showing 1 to 4 of 4 rows

10

rows per page

• ‹
• 1
• ›

Multiple sequence alignment

Antitoxin

Loading, please wait

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
AT168	Vibrio cholerae O1 biovar El Tor str. N16961	100	100	1
AT705	Vibrio parahaemolyticus RIMD 2210633	90.217	97.872	0.883

Showing 1 to 2 of 2 rows

10

rows per page

• ‹
• 1
• ›

Multiple sequence alignment

Structures

Toxin

Loading, please wait

• AlphaFold DB: Q9K2M8

Antitoxin

Loading, please wait

• AlphaFold DB: A0A067BL33

References

(1) Naeem Iqbal et al. (2015) Comprehensive Functional Analysis of the 18 Vibrio cholerae N16961 Toxin-Antitoxin Systems Substantiates Their Role in Stabilizing the Superintegron. Journal of Bacteriology 197(13):2150-9. [PubMed:25897030]


 experimental literature