Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | parDE/ParE-Phd |
Location | 320866..321444 | Replicon | chromosome |
Accession | NZ_CP024163 | ||
Organism | Vibrio cholerae strain E7946 |
Toxin (Protein)
Gene name | parE | Uniprot ID | O68848 |
Locus tag | CSW01_RS15585 | Protein ID | WP_001180243.1 |
Coordinates | 320866..321183 (-) | Length | 106 a.a. |
Antitoxin (Protein)
Gene name | parD | Uniprot ID | Q7DCR7 |
Locus tag | CSW01_RS15590 | Protein ID | WP_000557292.1 |
Coordinates | 321202..321444 (-) | Length | 81 a.a. |
Genomic Context
Location: 316390..316572 (183 bp)
Type: Others
Protein ID: WP_000923340.1
Type: Others
Protein ID: WP_000923340.1
Location: 316926..317108 (183 bp)
Type: Others
Protein ID: WP_000923153.1
Type: Others
Protein ID: WP_000923153.1
Location: 317303..317980 (678 bp)
Type: Others
Protein ID: WP_000254617.1
Type: Others
Protein ID: WP_000254617.1
Location: 318142..319350 (1209 bp)
Type: Others
Protein ID: WP_000272282.1
Type: Others
Protein ID: WP_000272282.1
Location: 319512..320216 (705 bp)
Type: Others
Protein ID: WP_000087610.1
Type: Others
Protein ID: WP_000087610.1
Location: 320374..320712 (339 bp)
Type: Others
Protein ID: WP_000713853.1
Type: Others
Protein ID: WP_000713853.1
Location: 321688..322074 (387 bp)
Type: Others
Protein ID: WP_001015867.1
Type: Others
Protein ID: WP_001015867.1
Location: 322131..322244 (114 bp)
Type: Others
Protein ID: WP_001900214.1
Type: Others
Protein ID: WP_001900214.1
Location: 322193..322474 (282 bp)
Type: Others
Protein ID: WP_001894429.1
Type: Others
Protein ID: WP_001894429.1
Location: 322732..323268 (537 bp)
Type: Others
Protein ID: WP_000469482.1
Type: Others
Protein ID: WP_000469482.1
Location: 323405..323920 (516 bp)
Type: Others
Protein ID: WP_001201509.1
Type: Others
Protein ID: WP_001201509.1
Location: 325229..325354 (126 bp)
Type: Others
Protein ID: WP_001900195.1
Type: Others
Protein ID: WP_001900195.1
Location: 325370..325408 (39 bp)
Type: Others
Protein ID: WP_106019118.1
Type: Others
Protein ID: WP_106019118.1
Location: 325604..326050 (447 bp)
Type: Others
Protein ID: WP_000006157.1
Type: Others
Protein ID: WP_000006157.1
Location: 320866..321183 (318 bp)
Type: Toxin
Protein ID: WP_001180243.1
Type: Toxin
Protein ID: WP_001180243.1
Location: 321202..321444 (243 bp)
Type: Antitoxin
Protein ID: WP_000557292.1
Type: Antitoxin
Protein ID: WP_000557292.1
Location: 324070..324567 (498 bp)
Type: Others
Protein ID: WP_000982260.1
Type: Others
Protein ID: WP_000982260.1
Location: 324564..324836 (273 bp)
Type: Others
Protein ID: WP_000246253.1
Type: Others
Protein ID: WP_000246253.1
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
CSW01_RS15535 | 316390..316572 | + | 183 | WP_000923340.1 | DUF645 family protein | - |
CSW01_RS15545 | 316926..317108 | + | 183 | WP_000923153.1 | DUF645 family protein | - |
CSW01_RS15560 | 317303..317980 | + | 678 | WP_000254617.1 | HNH endonuclease | - |
CSW01_RS15565 | 318142..319350 | + | 1209 | WP_000272282.1 | deoxyguanosinetriphosphate triphosphohydrolase family protein | - |
CSW01_RS15570 | 319512..320216 | + | 705 | WP_000087610.1 | HNH endonuclease | - |
CSW01_RS15575 | 320374..320712 | + | 339 | WP_000713853.1 | hypothetical protein | - |
CSW01_RS15585 | 320866..321183 | - | 318 | WP_001180243.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
CSW01_RS15590 | 321202..321444 | - | 243 | WP_000557292.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
CSW01_RS15595 | 321688..322074 | + | 387 | WP_001015867.1 | NUDIX hydrolase | - |
CSW01_RS15600 | 322131..322244 | + | 114 | WP_001900214.1 | hypothetical protein | - |
CSW01_RS15605 | 322193..322474 | + | 282 | WP_001894429.1 | DUF1289 domain-containing protein | - |
CSW01_RS15620 | 322732..323268 | + | 537 | WP_000469482.1 | GNAT family N-acetyltransferase | - |
CSW01_RS15625 | 323405..323920 | + | 516 | WP_001201509.1 | lipocalin family protein | - |
CSW01_RS15635 | 324070..324567 | - | 498 | WP_000982260.1 | GNAT family N-acetyltransferase | - |
CSW01_RS15640 | 324564..324836 | - | 273 | WP_000246253.1 | DUF1778 domain-containing protein | - |
CSW01_RS15650 | 325229..325354 | + | 126 | WP_001900195.1 | DUF645 family protein | - |
CSW01_RS19800 | 325370..325408 | + | 39 | WP_106019118.1 | hypothetical protein | - |
CSW01_RS15660 | 325604..326050 | + | 447 | WP_000006157.1 | hypothetical protein | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | catB9 | - | 304226..433944 | 129718 | |
inside | Integron | - | - | 309306..433568 | 124262 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 106 a.a. Molecular weight: 12158.97 Da Isoelectric Point: 9.7495
>T87016 WP_001180243.1 NZ_CP024163:c321183-320866 [Vibrio cholerae]
MQNKQYKLSQLAQEHLLKIKHYTIENFAEAQWQKYKSTLLSGFQTLADNPGLGKSCEDIYQNGFYFPVGKHMAYYTKEAN
FILIVAVLGQSQLPQKHLKQSRFVS
MQNKQYKLSQLAQEHLLKIKHYTIENFAEAQWQKYKSTLLSGFQTLADNPGLGKSCEDIYQNGFYFPVGKHMAYYTKEAN
FILIVAVLGQSQLPQKHLKQSRFVS
Download Length: 318 bp
>T87016 NZ_CP024163:c321183-320866 [Vibrio cholerae]
ATGCAAAATAAACAATATAAGCTCAGCCAATTAGCCCAAGAGCACTTACTCAAGATTAAACACTACACCATTGAAAATTT
CGCTGAAGCGCAGTGGCAAAAATATAAGTCGACCTTGCTTTCAGGTTTCCAAACTCTTGCGGATAACCCAGGACTAGGAA
AAAGCTGTGAAGATATTTACCAAAATGGTTTTTACTTTCCAGTGGGGAAACACATGGCTTATTACACCAAAGAAGCAAAC
TTCATTCTCATTGTTGCGGTATTAGGGCAATCACAACTGCCCCAAAAGCATCTCAAACAGTCACGCTTTGTTTCTTAG
ATGCAAAATAAACAATATAAGCTCAGCCAATTAGCCCAAGAGCACTTACTCAAGATTAAACACTACACCATTGAAAATTT
CGCTGAAGCGCAGTGGCAAAAATATAAGTCGACCTTGCTTTCAGGTTTCCAAACTCTTGCGGATAACCCAGGACTAGGAA
AAAGCTGTGAAGATATTTACCAAAATGGTTTTTACTTTCCAGTGGGGAAACACATGGCTTATTACACCAAAGAAGCAAAC
TTCATTCTCATTGTTGCGGTATTAGGGCAATCACAACTGCCCCAAAAGCATCTCAAACAGTCACGCTTTGTTTCTTAG
Antitoxin
Download Length: 81 a.a. Molecular weight: 8961.25 Da Isoelectric Point: 5.6630
>AT87016 WP_000557292.1 NZ_CP024163:c321444-321202 [Vibrio cholerae]
MHTLTANDAKRNFGELLLSAQREPVIISKNSKNTVVVMSIKDFEELEAMKLDYLKHCFESAQKDLDSGKTVDGATFLNTL
MHTLTANDAKRNFGELLLSAQREPVIISKNSKNTVVVMSIKDFEELEAMKLDYLKHCFESAQKDLDSGKTVDGATFLNTL
Download Length: 243 bp
>AT87016 NZ_CP024163:c321444-321202 [Vibrio cholerae]
ATGCACACACTAACAGCAAATGATGCTAAACGAAATTTTGGTGAACTTCTTCTAAGCGCACAACGCGAACCTGTCATCAT
CAGCAAAAACAGTAAGAATACTGTCGTTGTCATGTCCATTAAGGACTTTGAAGAACTTGAAGCAATGAAACTCGATTATC
TCAAACACTGCTTTGAGTCTGCTCAGAAAGACTTAGATAGTGGCAAAACCGTTGATGGTGCCACTTTTCTAAACACCCTT
TGA
ATGCACACACTAACAGCAAATGATGCTAAACGAAATTTTGGTGAACTTCTTCTAAGCGCACAACGCGAACCTGTCATCAT
CAGCAAAAACAGTAAGAATACTGTCGTTGTCATGTCCATTAAGGACTTTGAAGAACTTGAAGCAATGAAACTCGATTATC
TCAAACACTGCTTTGAGTCTGCTCAGAAAGACTTAGATAGTGGCAAAACCGTTGATGGTGCCACTTTTCTAAACACCCTT
TGA
Structures
Toxin
Loading, please wait
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0K9UJR8 |
Antitoxin
Loading, please wait
Source | ID | Structure |
---|---|---|
AlphaFold DB | Q7DCR7 |