Detailed information of TA system TA000172

Experimentally validated

Overview

TA module

• Type: II
• Classification (family/domain): relBE/PHD-RelE
• Location: 387652..388301
• Replicon: chromosome II
• Accession: NC_002506
• Organism: Vibrio cholerae O1 biovar El Tor str. N16961

Toxin (Protein)

• Gene name: relE
• Uniprot ID: -
• Locus tag: VC_RS15415
• Protein ID: Protein_396
• Coordinates: 387942..388193 (+)
• Length: 84 a.a.

Antitoxin (Protein)

• Gene name: relB
• Uniprot ID: D0IIK3
• Locus tag: VC_RS15410
• Protein ID: WP_000086649.1
• Coordinates: 387664..387945 (+)
• Length: 94 a.a.

Genomic Context

Location: 382786..383145 (360 bp)
Type: Others
Protein ID: WP_001071514.1

Location: 383328..383651 (324 bp)
Type: Others
Protein ID: WP_001889156.1

Location: 383932..384468 (537 bp)
Type: Others
Protein ID: WP_000469482.1

Location: 385229..385411 (183 bp)
Type: Others
Protein ID: WP_000947517.1

Location: 385530..386315 (786 bp)
Type: Others
Protein ID: WP_001176447.1

Location: 386417..386779 (363 bp)
Type: Others
Protein ID: WP_170831679.1

Location: 387025..387450 (426 bp)
Type: Others
Protein ID: WP_000735184.1

Location: 387664..387945 (282 bp)
Type: Antitoxin
Protein ID: WP_000086649.1

Location: 387942..388193 (252 bp)
Type: Toxin
Protein ID: Protein_396

Location: 388406..388729 (324 bp)
Type: Others
Protein ID: WP_001999495.1

Location: 389015..389410 (396 bp)
Type: Others
Protein ID: WP_000870868.1

Location: 389600..389821 (222 bp)
Type: Others
Protein ID: WP_043987927.1

Location: 390185..390610 (426 bp)
Type: Others
Protein ID: WP_000415748.1

Location: 390936..391169 (234 bp)
Type: Others
Protein ID: WP_001999499.1

Location: 391358..391753 (396 bp)
Type: Others
Protein ID: WP_001889207.1

Location: 391972..392361 (390 bp)
Type: Others
Protein ID: WP_000491261.1

Loading, please wait

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
VC_RS15375 (VC_A0415)	382786..383145	+	360	WP_001071514.1	VOC family protein	-
VC_RS15380 (VC_A0416)	383328..383651	+	324	WP_001889156.1	DUF3709 domain-containing protein	-
VC_RS15385 (VC_A0417)	383932..384468	+	537	WP_000469482.1	GNAT family N-acetyltransferase	-
VC_RS15390 (VC_A0418)	385229..385411	+	183	WP_000947517.1	DUF645 family protein	-
VC_RS15395 (VC_A0419)	385530..386315	+	786	WP_001176447.1	hypothetical protein	-
VC_RS15400 (VC_A0420)	386417..386779	+	363	WP_170831679.1	DUF4144 domain-containing protein	-
VC_RS15405 (VC_A0421)	387025..387450	+	426	WP_000735184.1	hypothetical protein	-
VC_RS15410 (VC_A0422)	387664..387945	+	282	WP_000086649.1	type II toxin-antitoxin system Phd/YefM family antitoxin	Antitoxin
VC_RS15415 (VC_A0423)	387942..388193	+	252	Protein_396	type II toxin-antitoxin system RelE/ParE family toxin	Toxin
VC_RS15420 (VC_A0424)	388406..388729	+	324	WP_001999495.1	DUF3709 domain-containing protein	-
VC_RS15425 (VC_A0425)	389015..389410	+	396	WP_000870868.1	DUF3465 domain-containing protein	-
VC_RS15435 (VC_A0426)	389600..389821	+	222	WP_043987927.1	DUF1289 domain-containing protein	-
VC_RS15445 (VC_A0428)	390185..390610	+	426	WP_000415748.1	hypothetical protein	-
VC_RS15450	390936..391169	+	234	WP_001999499.1	DUF3709 domain-containing protein	-
VC_RS15455 (VC_A0431)	391358..391753	+	396	WP_001889207.1	DUF4144 domain-containing protein	-
VC_RS15460 (VC_A0432)	391972..392361	+	390	WP_000491261.1	VOC family protein	-

Associated MGEs

Loading, please wait

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)
	Similar MGE(s) Similar MGE(s) is defined as other TA-related MGE(s) with Mash distance < 0.01 to this MGE. Detail Genome accession Organism MGE type Related TA Coordinates Mash distance View NC_012667 Vibrio cholerae MJ-1236 Integron TA023781, TA023782, TA023783, TA023784, TA023785, TA023786, TA023787, TA023788, TA023789, TA023790, TA023791, TA023792, TA023793, TA023794, TA023795 958376..1050596 0.006 View NC_016446 Vibrio cholerae O1 str. 2010EL-1786 Integron TA025705, TA025706, TA025707, TA025708, TA025709, TA025710, TA025711, TA025712, TA025713, TA025714, TA025715, TA025716, TA025717, TA025718, TA025719, TA025720, TA025721, TA025722 36195..135928 0.004 View NC_016945 Vibrio cholerae IEC224 Integron TA026143, TA026144, TA026145, TA026146, TA026147, TA026148, TA026149, TA026150, TA026151, TA026152, TA026153, TA026154, TA026155, TA026156, TA026157, TA026158, TA026159, TA026160 309717..435206 0 View NZ_AP024548 Vibrio cholerae strain BCH-01536 Integron TA038617, TA038618, TA038619, TA038620, TA038621, TA038622, TA038623, TA038624, TA038625, TA038626, TA038627, TA038628, TA038629, TA038630, TA038631, TA038632 11978..113648 0.004 View NZ_AP024554 Vibrio cholerae strain IDH-03329 Integron TA038668, TA038669, TA038670, TA038671, TA038672, TA038673, TA038674, TA038675, TA038676, TA038677, TA038678, TA038679, TA038680, TA038681, TA038682, TA038683, TA038684 213119..312856 0.004 View NZ_CP006948 Vibrio cholerae O1 str. KW3 Integron TA045802, TA045803, TA045804, TA045805, TA045806, TA045807, TA045808, TA045809, TA045810, TA045811, TA045812, TA045813, TA045814, TA045815, TA045816, TA045817, TA045818, TA045819 309725..410760 0.004 View NZ_CP007635 Vibrio cholerae strain 2012EL-2176 Integron TA046749, TA046750, TA046751, TA046752, TA046753, TA046754, TA046755, TA046756, TA046757, TA046758, TA046759, TA046760, TA046761, TA046762, TA046763, TA046764, TA046765, TA046766 36117..137166 0.004 View NZ_CP009041 Vibrio cholerae O1 biovar El Tor strain FJ147 Integron TA048145, TA048146, TA048147, TA048148, TA048149, TA048150, TA048151, TA048152, TA048153, TA048154, TA048155, TA048156, TA048157, TA048158, TA048159, TA048160, TA048161, TA048162 309780..409516 0.004 View NZ_CP012666 Vibrio cholerae strain ICDC-VC661 Integron TA056924, TA056909, TA056910, TA056911, TA056912, TA056913, TA056914, TA056915, TA056916, TA056917, TA056918, TA056919, TA056920, TA056921, TA056922, TA056923, TA056925 309725..399516 0.005 View NZ_CP013302 Vibrio cholerae strain C5 Integron TA058213, TA058214, TA058215, TA058216, TA058217, TA058218, TA058219, TA058220, TA058221, TA058222, TA058223, TA058224, TA058225, TA058226, TA058227, TA058228, TA058229, TA058230, TA058231, TA058232, TA058233, TA058234, TA058235 309774..468910 0.005 View NZ_CP013306 Vibrio cholerae strain CRC1106 Integron TA058258, TA058259, TA058260, TA058261, TA058262, TA058263, TA058264, TA058265, TA058266, TA058267, TA058268, TA058269, TA058270, TA058271, TA058272, TA058273, TA058274, TA058275, TA058276, TA058277, TA058278, TA058279, TA058280 309821..463174 0.006 View NZ_CP013310 Vibrio cholerae strain E1162 Integron TA058301, TA058302, TA058303, TA058304, TA058305, TA058306, TA058307, TA058308, TA058309, TA058310, TA058311, TA058312, TA058313, TA058314, TA058315, TA058316, TA058317, TA058318, TA058319, TA058320, TA058321, TA058322, TA058323 440614..596283 0.005 View NZ_CP013314 Vibrio cholerae strain E9120 Integron TA058348, TA058349, TA058350, TA058351, TA058352, TA058353, TA058354, TA058355, TA058356, TA058357, TA058358, TA058359, TA058360, TA058361, TA058362, TA058363, TA058364, TA058365, TA058366, TA058367, TA058368, TA058369, TA058370 309780..468088 0.005 View NZ_CP013316 Vibrio cholerae strain M2140 Integron TA058372, TA058373, TA058374, TA058375, TA058376, TA058377, TA058378, TA058379, TA058380, TA058381, TA058382, TA058383, TA058384, TA058385, TA058386, TA058387, TA058388, TA058389 93061..221594 0.008 View NZ_CP013318 Vibrio cholerae strain NCTC5395 Integron TA058391, TA058392, TA058393, TA058394, TA058395, TA058396, TA058397, TA058398, TA058399, TA058400, TA058401, TA058402, TA058403, TA058404, TA058405, TA058406, TA058407, TA058408, TA058409, TA058410, TA058411 343365..496457 0.009 View NZ_CP020407 Vibrio cholerae strain FDAARGOS_223 Integron TA074614, TA074615, TA074616, TA074617, TA074618, TA074619, TA074620, TA074621, TA074622, TA074623, TA074624, TA074625, TA074626, TA074627, TA074628, TA074629, TA074630, TA074631 749463..875103 0 View NZ_CP024163 Vibrio cholerae strain E7946 Integron TA087016, TA087017, TA087018, TA087019, TA087020, TA087021, TA087022, TA087023, TA087024, TA087025, TA087026, TA087027, TA087028, TA087029, TA087030, TA087031, TA087032, TA087033 309306..433568 0 View NZ_CP024868 Vibrio cholerae strain A1552 Integron TA088996, TA088997, TA088987, TA088988, TA088989, TA088990, TA088991, TA088992, TA088993, TA088994, TA088995, TA088998, TA088999, TA089000, TA089001, TA089002, TA089003, TA089004 309797..433602 0 View NZ_CP025937 Vibrio cholerae strain A1552 Integron TA092502, TA092503, TA092504, TA092505, TA092506, TA092507, TA092508, TA092509, TA092510, TA092511, TA092512, TA092513, TA092514, TA092515, TA092516, TA092517, TA092518, TA092519 309147..432952 0 View NZ_CP026648 Vibrio cholerae O1 biovar El Tor strain HC1037 Integron TA095391, TA095375, TA095376, TA095377, TA095378, TA095379, TA095380, TA095381, TA095382, TA095383, TA095384, TA095385, TA095386, TA095387, TA095388, TA095389, TA095390, TA095392 36123..135858 0.004 View NZ_CP028828 Vibrio cholerae strain N16961 Integron TA104260, TA104261, TA104247, TA104248, TA104249, TA104250, TA104251, TA104252, TA104253, TA104254, TA104255, TA104256, TA104257, TA104258, TA104259, TA104262, TA104263, TA104264 312057..437697 0 View NZ_CP028895 Vibrio cholerae strain A1552 Integron TA104335, TA104336, TA104337, TA104338, TA104339, TA104340, TA104341, TA104342, TA104343, TA104344, TA104345, TA104346, TA104347, TA104348, TA104349, TA104350, TA104351, TA104352 311994..435799 0 View NZ_CP033513 Vibrio cholerae strain E4 Integron TA113805, TA113806, TA113807, TA113808, TA113794, TA113795, TA113796, TA113797, TA113798, TA113799, TA113800, TA113801, TA113802, TA113803, TA113804, TA113809, TA113810, TA113811 127139..226875 0.004 View NZ_CP040173 Vibrio cholerae strain VC1374 Integron TA125036, TA125037, TA125038, TA125039, TA125040, TA125041, TA125042, TA125043, TA125044, TA125045, TA125046, TA125047, TA125048, TA125049, TA125050, TA125051, TA125052 887669..977464 0.005 View NZ_CP046841 Vibrio cholerae strain F9993 Integron TA145056, TA145057, TA145058, TA145059, TA145060, TA145061, TA145062, TA145063, TA145064, TA145065, TA145066, TA145067, TA145068, TA145069, TA145070, TA145071, TA145072 322432..412236 0.005 View NZ_CP047060 Vibrio cholerae isolate CTMA_1441 Integron TA145398, TA145399, TA145392, TA145393, TA145394, TA145395, TA145396, TA145397, TA145400, TA145401, TA145402, TA145403, TA145404, TA145405, TA145406, TA145407, TA145408, TA145409 311040..410783 0.004 View NZ_CP047296 Vibrio cholerae C6706 Integron TA145820, TA145815, TA145816, TA145817, TA145818, TA145819, TA145803, TA145804, TA145805, TA145806, TA145807, TA145808, TA145809, TA145810, TA145811, TA145812, TA145813, TA145814, TA145821 311985..435789 0 View NZ_CP047298 Vibrio cholerae O1 biovar El Tor strain C6709 Integron TA145823, TA145824, TA145825, TA145826, TA145827, TA145828, TA145829, TA145830, TA145831, TA145832, TA145833, TA145834, TA145835, TA145836, TA145837, TA145838, TA145839, TA145840, TA145841 311981..435786 0 View NZ_CP047300 Vibrio cholerae O1 biovar El Tor strain P27459 Integron TA145843, TA145844, TA145845, TA145846, TA145847, TA145848, TA145849, TA145850, TA145851, TA145852, TA145853, TA145854, TA145855, TA145856, TA145857, TA145858, TA145859, TA145860, TA145861 312006..438916 0 View NZ_CP047302 Vibrio cholerae O1 biovar El Tor strain DRC-193A Integron TA145864, TA145865, TA145866, TA145867, TA145868, TA145869, TA145870, TA145871, TA145872, TA145873, TA145874, TA145875, TA145876, TA145877, TA145878, TA145879, TA145880, TA145881 311015..410760 0.004 View NZ_CP047304 Vibrio cholerae O1 biovar El Tor strain E7946 Integron TA145883, TA145884, TA145885, TA145886, TA145887, TA145888, TA145889, TA145890, TA145891, TA145892, TA145893, TA145894, TA145895, TA145896, TA145897, TA145898, TA145899, TA145900, TA145901 312112..436375 0 View NZ_CP064351 Vibrio cholerae C6706 Integron TA180865, TA180866, TA180867, TA180868, TA180869, TA180870, TA180871, TA180872, TA180873, TA180874, TA180875, TA180876, TA180877, TA180878, TA180879, TA180880, TA180881, TA180882 378284..502088 0 View NZ_CP072848 Vibrio cholerae strain A1552 Integron TA198989, TA198978, TA198979, TA198980, TA198981, TA198982, TA198983, TA198984, TA198985, TA198986, TA198987, TA198988, TA198990, TA198991, TA198992, TA198993, TA198994 311994..435799 0 View NZ_CP072850 Vibrio cholerae MO10 Integron TA198998, TA198999, TA199000, TA199001, TA199002, TA199003, TA199004, TA199005, TA199006, TA199007, TA199008, TA199009, TA199010, TA199011, TA199012, TA199013 312008..401813 0.005 View NZ_CP080466 Vibrio cholerae strain ICDC-VC3741 Integron TA211906, TA211907, TA211908, TA211909, TA211910, TA211911, TA211912, TA211913, TA211914, TA211915, TA211916, TA211917, TA211918, TA211919, TA211920, TA211921, TA211922 933056..1032792 0.004 View NZ_CP090379 Vibrio cholerae strain BY369 Integron TA230515, TA230516, TA230517, TA230518, TA230519, TA230520, TA230521, TA230522, TA230523, TA230524, TA230525, TA230526, TA230527, TA230528, TA230529, TA230530 309725..399516 0.005 View NZ_CP090400 Vibrio cholerae strain PanChol Integron TA230635, TA230636, TA230637, TA230638, TA230639, TA230640, TA230641, TA230642, TA230643, TA230644, TA230645, TA230646, TA230647, TA230648, TA230649, TA230650, TA230651 836019..937068 0.004 View NZ_CP102928 Vibrio cholerae strain N1252 Integron TA254465, TA254466, TA254467, TA254468, TA254469, TA254470, TA254471, TA254472, TA254473, TA254474, TA254475, TA254476, TA254477, TA254478, TA254479, TA254480, TA254481 718932..819981 0.004 View NZ_LT906615 Vibrio cholerae O1 biovar El Tor str. N16961 Integron TA293792, TA293793, TA293794, TA293795, TA293796, TA293797, TA293798, TA293799, TA293800, TA293801, TA293802, TA293803, TA293804, TA293805, TA293806, TA293807, TA293808, TA293809 309746..435385 0 View NZ_LT907990 Vibrio cholerae strain A19 Integron TA293821, TA293822, TA293823, TA293824, TA293825, TA293826, TA293827, TA293828, TA293829, TA293830, TA293831, TA293832, TA293833, TA293834, TA293835, TA293836, TA293837, TA293838 309746..435385 0 View NZ_LT992487 Vibrio cholerae strain 4295STDY6534216 Integron TA294348, TA294349, TA294350, TA294351, TA294352, TA294353, TA294354, TA294355, TA294356, TA294357, TA294358, TA294359, TA294360, TA294361, TA294362, TA294363, TA294364 897901..987709 0.005 View NZ_LT992489 Vibrio cholerae strain 4295STDY6534232 Integron TA294368, TA294369, TA294370, TA294371, TA294372, TA294373, TA294374, TA294375, TA294376, TA294377, TA294378, TA294379, TA294380, TA294381, TA294382, TA294383, TA294384 379701..469509 0.005 View NZ_LT992493 Vibrio cholerae strain 4295STDY6534248 Integron TA294406, TA294407, TA294408, TA294409, TA294410, TA294411, TA294412, TA294413, TA294414, TA294415, TA294416, TA294417, TA294418, TA294419, TA294420, TA294421, TA294422 202848..292656 0.005 View NZ_OW443148 Vibrio cholerae strain CNRVC190243 isolate YE-NCPHL-19014-PI Integron TA295386, TA295387, TA295388, TA295389, TA295390, TA295391, TA295392, TA295393, TA295394, TA295395, TA295396, TA295397, TA295398, TA295399, TA295400, TA295401, TA295402 354985..456034 0.004	inside	Integron	catB9	-	309750..435387	125637

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Toxin-antitoxin system, RelE/ParE toxin family (3-81)

Antitoxin

• Type II toxin-antitoxin system, antitoxin Phd/YefM (9-74)

Sequences

Toxin

Protein

• Length: 84 a.a.
• Molecular weight: 9702.31 Da
• Isoelectric Point: 6.2167

>T172 Protein_396 NC_002506:387942-388193 [Vibrio cholerae O1 biovar El Tor str. N16961]
MKVVWSPLALQKLGDAAEFIALDNPSAAEKWVNEVFDKTELLGSMPEMGRMVPEMPHTNYREIIFGHYRIIYSLSHEIRV
LTLR

Nucleotide

• Length: 252 bp

>T172 NC_002506:387942-388193 [Vibrio cholerae O1 biovar El Tor str. N16961]
ATGAAAGTAGTTTGGTCACCTCTAGCGTTACAAAAACTGGGTGATGCCGCAGAGTTTATTGCTTTGGATAACCCATCAGC
TGCAGAAAAGTGGGTGAATGAAGTATTCGACAAAACGGAATTGCTCGGCTCAATGCCAGAAATGGGCCGCATGGTTCCTG
AAATGCCTCATACGAACTACCGTGAAATAATTTTTGGTCATTACCGCATTATTTATAGTTTGAGCCACGAAATCCGCGTT
CTAACATTACGT

Antitoxin

Protein

• Length: 94 a.a.
• Molecular weight: 10361.93 Da
• Isoelectric Point: 5.1548

>AT172 WP_000086649.1 NC_002506:387664-387945 [Vibrio cholerae O1 biovar El Tor str. N16961]
MSRIHLDQDIQPLSEFRAGVASFIKQINETRRPLVITQRGKGVAVVLDVAEYEAMQEKIELLEEMRTAEAQLAAGLGISN
EDARSQVLGRIIK

Nucleotide

• Length: 282 bp

>AT172 NC_002506:387664-387945 [Vibrio cholerae O1 biovar El Tor str. N16961]
ATGAGCCGTATTCACCTTGATCAAGATATTCAGCCTTTGTCTGAGTTCCGTGCTGGCGTTGCATCATTTATCAAACAGAT
CAATGAGACTCGTCGACCATTGGTTATTACACAACGAGGTAAAGGTGTAGCCGTTGTTCTTGACGTTGCGGAGTATGAAG
CAATGCAAGAGAAAATCGAATTACTCGAAGAAATGCGTACTGCAGAAGCTCAATTGGCTGCAGGTTTAGGTATATCAAAC
GAAGATGCTCGTTCACAAGTTCTGGGGCGCATCATCAAATGA

Similar Proteins

Only experimentally validated proteins are listed.

Toxin

Loading, please wait

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
T178	Vibrio cholerae O1 biovar El Tor str. N16961	42.683	97.619	0.417

Showing 1 to 1 of 1 rows

10

rows per page

• ‹
• 1
• ›

Multiple sequence alignment

Antitoxin

Loading, please wait

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
AT10077	Agrobacterium tumefaciens str. C58	41.538	77.381	0.321
AT6285	Streptomyces cattleya NRRL 8057 = DSM 46488	31.395	96.629	0.303

Showing 1 to 2 of 2 rows

10

rows per page

• ‹
• 1
• ›

Multiple sequence alignment

Structures

Toxin

Loading, please wait

Source	ID	Structure
No matching records found

Antitoxin

Loading, please wait

• AlphaFold DB: A0A0K9UIW4

References

(1) Naeem Iqbal et al. (2015) Comprehensive Functional Analysis of the 18 Vibrio cholerae N16961 Toxin-Antitoxin Systems Substantiates Their Role in Stabilizing the Superintegron. Journal of Bacteriology 197(13):2150-9. [PubMed:25897030]


 experimental literature