Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | /GNAT-DUF1778 |
Location | 325804..326570 | Replicon | chromosome |
Accession | NZ_CP047060 | ||
Organism | Vibrio cholerae isolate CTMA_1441 |
Toxin (Protein)
Gene name | - | Uniprot ID | Q9K2P7 |
Locus tag | GQX72_RS15230 | Protein ID | WP_000982260.1 |
Coordinates | 325804..326301 (-) | Length | 166 a.a. |
Antitoxin (Protein)
Gene name | - | Uniprot ID | Q9K2J6 |
Locus tag | GQX72_RS15235 | Protein ID | WP_000246253.1 |
Coordinates | 326298..326570 (-) | Length | 91 a.a. |
Genomic Context
Location: 321246..321950 (705 bp)
Type: Others
Protein ID: WP_000087610.1
Type: Others
Protein ID: WP_000087610.1
Location: 322108..322446 (339 bp)
Type: Others
Protein ID: WP_000713853.1
Type: Others
Protein ID: WP_000713853.1
Location: 323422..323808 (387 bp)
Type: Others
Protein ID: WP_001015867.1
Type: Others
Protein ID: WP_001015867.1
Location: 323865..323978 (114 bp)
Type: Others
Protein ID: WP_001900214.1
Type: Others
Protein ID: WP_001900214.1
Location: 323927..324208 (282 bp)
Type: Others
Protein ID: WP_001894429.1
Type: Others
Protein ID: WP_001894429.1
Location: 324466..325002 (537 bp)
Type: Others
Protein ID: WP_000469482.1
Type: Others
Protein ID: WP_000469482.1
Location: 325139..325654 (516 bp)
Type: Others
Protein ID: WP_001201509.1
Type: Others
Protein ID: WP_001201509.1
Location: 326963..327088 (126 bp)
Type: Others
Protein ID: WP_001905700.1
Type: Others
Protein ID: WP_001905700.1
Location: 327338..327784 (447 bp)
Type: Others
Protein ID: WP_000006157.1
Type: Others
Protein ID: WP_000006157.1
Location: 328758..329036 (279 bp)
Type: Others
Protein ID: WP_001921601.1
Type: Others
Protein ID: WP_001921601.1
Location: 329288..329494 (207 bp)
Type: Others
Protein ID: Protein_290
Type: Others
Protein ID: Protein_290
Location: 329694..329795 (102 bp)
Type: Others
Protein ID: WP_001921603.1
Type: Others
Protein ID: WP_001921603.1
Location: 329785..330171 (387 bp)
Type: Others
Protein ID: WP_000703163.1
Type: Others
Protein ID: WP_000703163.1
Location: 330366..330617 (252 bp)
Type: Others
Protein ID: WP_001890111.1
Type: Others
Protein ID: WP_001890111.1
Location: 330590..330739 (150 bp)
Type: Others
Protein ID: WP_071908333.1
Type: Others
Protein ID: WP_071908333.1
Location: 330831..331073 (243 bp)
Type: Others
Protein ID: WP_000107461.1
Type: Others
Protein ID: WP_000107461.1
Location: 322600..322917 (318 bp)
Type: Others
Protein ID: WP_001180243.1
Type: Others
Protein ID: WP_001180243.1
Location: 322936..323178 (243 bp)
Type: Others
Protein ID: WP_000557292.1
Type: Others
Protein ID: WP_000557292.1
Location: 325804..326301 (498 bp)
Type: Toxin
Protein ID: WP_000982260.1
Type: Toxin
Protein ID: WP_000982260.1
Location: 326298..326570 (273 bp)
Type: Antitoxin
Protein ID: WP_000246253.1
Type: Antitoxin
Protein ID: WP_000246253.1
Location: 327932..328201 (270 bp)
Type: Others
Protein ID: WP_000277238.1
Type: Others
Protein ID: WP_000277238.1
Location: 328194..328472 (279 bp)
Type: Others
Protein ID: WP_001258569.1
Type: Others
Protein ID: WP_001258569.1
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
GQX72_RS15175 | 321246..321950 | + | 705 | WP_000087610.1 | HNH endonuclease | - |
GQX72_RS15180 | 322108..322446 | + | 339 | WP_000713853.1 | hypothetical protein | - |
GQX72_RS15190 | 322600..322917 | - | 318 | WP_001180243.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
GQX72_RS15195 | 322936..323178 | - | 243 | WP_000557292.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | - |
GQX72_RS15200 | 323422..323808 | + | 387 | WP_001015867.1 | NUDIX hydrolase | - |
GQX72_RS15205 | 323865..323978 | + | 114 | WP_001900214.1 | hypothetical protein | - |
GQX72_RS15210 | 323927..324208 | + | 282 | WP_001894429.1 | DUF1289 domain-containing protein | - |
GQX72_RS15220 | 324466..325002 | + | 537 | WP_000469482.1 | GNAT family N-acetyltransferase | - |
GQX72_RS15225 | 325139..325654 | + | 516 | WP_001201509.1 | lipocalin family protein | - |
GQX72_RS15230 | 325804..326301 | - | 498 | WP_000982260.1 | GNAT family N-acetyltransferase | Toxin |
GQX72_RS15235 | 326298..326570 | - | 273 | WP_000246253.1 | DUF1778 domain-containing protein | Antitoxin |
GQX72_RS15240 | 326963..327088 | + | 126 | WP_001905700.1 | DUF645 family protein | - |
GQX72_RS15250 | 327338..327784 | + | 447 | WP_000006157.1 | hypothetical protein | - |
GQX72_RS15255 | 327932..328201 | - | 270 | WP_000277238.1 | type II toxin-antitoxin system YafQ family toxin | - |
GQX72_RS15260 | 328194..328472 | - | 279 | WP_001258569.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | - |
GQX72_RS15265 | 328758..329036 | + | 279 | WP_001921601.1 | DUF3709 domain-containing protein | - |
GQX72_RS15270 | 329288..329494 | + | 207 | Protein_290 | DUF3709 domain-containing protein | - |
GQX72_RS15275 | 329694..329795 | + | 102 | WP_001921603.1 | hypothetical protein | - |
GQX72_RS15280 | 329785..330171 | + | 387 | WP_000703163.1 | VOC family protein | - |
GQX72_RS15285 | 330366..330617 | + | 252 | WP_001890111.1 | TIGR03643 family protein | - |
GQX72_RS15290 | 330590..330739 | + | 150 | WP_071908333.1 | DUF3265 domain-containing protein | - |
GQX72_RS15295 | 330831..331073 | + | 243 | WP_000107461.1 | hypothetical protein | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | catB9 | - | 305960..411159 | 105199 | |
inside | Integron | - | - | 311040..410783 | 99743 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 166 a.a. Molecular weight: 18527.18 Da Isoelectric Point: 8.7753
>T145393 WP_000982260.1 NZ_CP047060:c326301-325804 [Vibrio cholerae]
MMNTVLLDKDKHDRNRFNCGTEALNNYLKVMASQQAKKDNTRTFVLEDDNNSAYIIGFYTLTMTPIDLKALPDKLQKKHQ
SSTSGGLIARLAVDDRYKGKGFGEWLLIDALRKLLAASDSVAFPVVIVDAKDGAKHFYERYGFQAFQDAENKLFITIADI
RASLG
MMNTVLLDKDKHDRNRFNCGTEALNNYLKVMASQQAKKDNTRTFVLEDDNNSAYIIGFYTLTMTPIDLKALPDKLQKKHQ
SSTSGGLIARLAVDDRYKGKGFGEWLLIDALRKLLAASDSVAFPVVIVDAKDGAKHFYERYGFQAFQDAENKLFITIADI
RASLG
Download Length: 498 bp
>T145393 NZ_CP062372:c827356-827168 [Staphylococcus aureus]
ATGTCTTTACATTTTGCAATTCTGTTTTGGCTAGCATTAATTTTCTTAGTTGCCGCTACGTTTATACTCGTATTAATGAA
AAAAACTGGCAAAGAATCTAAAAAAGAGTCCTATTTAAGTTTCACTGTCATTCTCTATATTTTTGGATTCGCTATATTAA
TATACACATTTATATTTGGTGTGCTATAA
ATGTCTTTACATTTTGCAATTCTGTTTTGGCTAGCATTAATTTTCTTAGTTGCCGCTACGTTTATACTCGTATTAATGAA
AAAAACTGGCAAAGAATCTAAAAAAGAGTCCTATTTAAGTTTCACTGTCATTCTCTATATTTTTGGATTCGCTATATTAA
TATACACATTTATATTTGGTGTGCTATAA
Antitoxin
Download Length: 91 a.a. Molecular weight: 9683.22 Da Isoelectric Point: 6.2988
>AT145393 WP_000246253.1 NZ_CP047060:c326570-326298 [Vibrio cholerae]
MATTLPRITARVDVDTQDLLAKAAALAGMSSINSFVLNAAIEKAKQVIEREQALKLSQADAVLLMEALDNPAVVNAKLKL
ASERYESKTQ
MATTLPRITARVDVDTQDLLAKAAALAGMSSINSFVLNAAIEKAKQVIEREQALKLSQADAVLLMEALDNPAVVNAKLKL
ASERYESKTQ
Download Length: 273 bp
>AT145393 NZ_CP062372:c827645-827385 [Staphylococcus aureus]
ATGAATAACATTTTGTTAAATGCTATCAATATAGTTATTACTACCACTTTTGTTATCTTTAATATTTTAATCACATATAA
TAAAGATTTAGATGATTTATGTTGGCTCCTGCCTGGTATTATCATTTGTGGTGTGATACTCATCGTATCCTTTACCATTG
CAATGATAACTAAAAACTGGTTAAGTGAAATATTATTTTTTATAAATATCGTACTCGTTCTCTATTACATTTATCCTATT
TTTTATAGTTTTATAGGTTAA
ATGAATAACATTTTGTTAAATGCTATCAATATAGTTATTACTACCACTTTTGTTATCTTTAATATTTTAATCACATATAA
TAAAGATTTAGATGATTTATGTTGGCTCCTGCCTGGTATTATCATTTGTGGTGTGATACTCATCGTATCCTTTACCATTG
CAATGATAACTAAAAACTGGTTAAGTGAAATATTATTTTTTATAAATATCGTACTCGTTCTCTATTACATTTATCCTATT
TTTTATAGTTTTATAGGTTAA
Structures
Toxin
Loading, please wait
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0Q0KGB1 |
Antitoxin
Loading, please wait
Source | ID | Structure |
---|---|---|
PDB | 1Y9B | |
AlphaFold DB | A0A0F2IC79 |