Detailed information of TA system TA000171

Experimentally validated

Overview

TA module

• Type: II
• Classification (family/domain): higBA (relBE)/Xre-RelE
• Location: 369360..370041
• Replicon: chromosome II
• Accession: NC_002506
• Organism: Vibrio cholerae O1 biovar El Tor str. N16961

Toxin (Protein)

• Gene name: higB
• Uniprot ID: Q9KMG5
• Locus tag: VC_RS15265
• Protein ID: WP_001162670.1
• Coordinates: 369426..369713 (+)
• Length: 96 a.a.

Antitoxin (Protein)

• Gene name: higA
• Uniprot ID: -
• Locus tag: VC_RS15270
• Protein ID: WP_001232701.1
• Coordinates: 369724..370041 (+)
• Length: 106 a.a.

Genomic Context

Location: 364413..364706 (294 bp)
Type: Others
Protein ID: WP_125460920.1

Location: 365062..365157 (96 bp)
Type: Others
Protein ID: WP_001907607.1

Location: 366171..366680 (510 bp)
Type: Others
Protein ID: WP_000409153.1

Location: 366737..367390 (654 bp)
Type: Others
Protein ID: WP_000226874.1

Location: 367700..367918 (219 bp)
Type: Others
Protein ID: WP_001917086.1

Location: 368321..368554 (234 bp)
Type: Others
Protein ID: WP_032482776.1

Location: 368979..369159 (181 bp)
Type: Others
Protein ID: Protein_363

Location: 369426..369713 (288 bp)
Type: Toxin
Protein ID: WP_001162670.1

Location: 369724..370041 (318 bp)
Type: Antitoxin
Protein ID: WP_001232701.1

Location: 370038..370148 (111 bp)
Type: Others
Protein ID: WP_134814058.1

Location: 370325..370450 (126 bp)
Type: Others
Protein ID: WP_001944767.1

Location: 370466..370504 (39 bp)
Type: Others
Protein ID: WP_106019119.1

Location: 370728..371468 (741 bp)
Type: Others
Protein ID: WP_000469836.1

Location: 371673..372503 (831 bp)
Type: Others
Protein ID: WP_000056616.1

Location: 372560..373042 (483 bp)
Type: Others
Protein ID: WP_001895003.1

Location: 373489..374364 (876 bp)
Type: Others
Protein ID: WP_000259044.1

Location: 374494..374949 (456 bp)
Type: Others
Protein ID: WP_001245327.1

Location: 365351..365668 (318 bp)
Type: Others
Protein ID: WP_001180243.1

Location: 365687..365929 (243 bp)
Type: Others
Protein ID: WP_000557292.1

Loading, please wait

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
VC_RS15220	364413..364706	+	294	WP_125460920.1	hypothetical protein	-
VC_RS18720 (VC_A0384)	365062..365157	+	96	WP_001907607.1	DUF645 family protein	-
VC_RS15230 (VC_A0385)	365351..365668	-	318	WP_001180243.1	type II toxin-antitoxin system RelE/ParE family toxin	-
VC_RS15235 (VC_A0386)	365687..365929	-	243	WP_000557292.1	type II toxin-antitoxin system Phd/YefM family antitoxin	-
VC_RS15240 (VC_A0387)	366171..366680	+	510	WP_000409153.1	GNAT family N-acetyltransferase	-
VC_RS15245 (VC_A0388)	366737..367390	+	654	WP_000226874.1	hypothetical protein	-
VC_RS15250 (VC_A0389)	367700..367918	+	219	WP_001917086.1	DUF3709 domain-containing protein	-
VC_RS15255	368321..368554	+	234	WP_032482776.1	DUF3709 domain-containing protein	-
VC_RS15260	368979..369159	+	181	Protein_363	DUF645 family protein	-
VC_RS15265 (VC_A0391)	369426..369713	+	288	WP_001162670.1	type II toxin-antitoxin system RelE/ParE family toxin	Toxin
VC_RS15270 (VC_A0392)	369724..370041	+	318	WP_001232701.1	HigA family addiction module antidote protein	Antitoxin
VC_RS18745	370038..370148	+	111	WP_134814058.1	DUF3265 domain-containing protein	-
VC_RS18655 (VC_A0393)	370325..370450	+	126	WP_001944767.1	DUF645 family protein	-
VC_RS18660	370466..370504	+	39	WP_106019119.1	hypothetical protein	-
VC_RS15285 (VC_A0395)	370728..371468	+	741	WP_000469836.1	PhzF family phenazine biosynthesis protein	-
VC_RS15290 (VC_A0396)	371673..372503	+	831	WP_000056616.1	abortive infection family protein	-
VC_RS15295 (VC_A0397)	372560..373042	+	483	WP_001895003.1	hypothetical protein	-
VC_RS15300 (VC_A0399)	373489..374364	+	876	WP_000259044.1	hypothetical protein	-
VC_RS15305 (VC_A0400)	374494..374949	+	456	WP_001245327.1	GNAT family N-acetyltransferase	-

Associated MGEs

Loading, please wait

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)
	Similar MGE(s) Similar MGE(s) is defined as other TA-related MGE(s) with Mash distance < 0.01 to this MGE. Detail Genome accession Organism MGE type Related TA Coordinates Mash distance View NC_012667 Vibrio cholerae MJ-1236 Integron TA023781, TA023782, TA023783, TA023784, TA023785, TA023786, TA023787, TA023788, TA023789, TA023790, TA023791, TA023792, TA023793, TA023794, TA023795 958376..1050596 0.006 View NC_016446 Vibrio cholerae O1 str. 2010EL-1786 Integron TA025705, TA025706, TA025707, TA025708, TA025709, TA025710, TA025711, TA025712, TA025713, TA025714, TA025715, TA025716, TA025717, TA025718, TA025719, TA025720, TA025721, TA025722 36195..135928 0.004 View NC_016945 Vibrio cholerae IEC224 Integron TA026143, TA026144, TA026145, TA026146, TA026147, TA026148, TA026149, TA026150, TA026151, TA026152, TA026153, TA026154, TA026155, TA026156, TA026157, TA026158, TA026159, TA026160 309717..435206 0 View NZ_AP024548 Vibrio cholerae strain BCH-01536 Integron TA038617, TA038618, TA038619, TA038620, TA038621, TA038622, TA038623, TA038624, TA038625, TA038626, TA038627, TA038628, TA038629, TA038630, TA038631, TA038632 11978..113648 0.004 View NZ_AP024554 Vibrio cholerae strain IDH-03329 Integron TA038668, TA038669, TA038670, TA038671, TA038672, TA038673, TA038674, TA038675, TA038676, TA038677, TA038678, TA038679, TA038680, TA038681, TA038682, TA038683, TA038684 213119..312856 0.004 View NZ_CP006948 Vibrio cholerae O1 str. KW3 Integron TA045802, TA045803, TA045804, TA045805, TA045806, TA045807, TA045808, TA045809, TA045810, TA045811, TA045812, TA045813, TA045814, TA045815, TA045816, TA045817, TA045818, TA045819 309725..410760 0.004 View NZ_CP007635 Vibrio cholerae strain 2012EL-2176 Integron TA046749, TA046750, TA046751, TA046752, TA046753, TA046754, TA046755, TA046756, TA046757, TA046758, TA046759, TA046760, TA046761, TA046762, TA046763, TA046764, TA046765, TA046766 36117..137166 0.004 View NZ_CP009041 Vibrio cholerae O1 biovar El Tor strain FJ147 Integron TA048145, TA048146, TA048147, TA048148, TA048149, TA048150, TA048151, TA048152, TA048153, TA048154, TA048155, TA048156, TA048157, TA048158, TA048159, TA048160, TA048161, TA048162 309780..409516 0.004 View NZ_CP012666 Vibrio cholerae strain ICDC-VC661 Integron TA056924, TA056909, TA056910, TA056911, TA056912, TA056913, TA056914, TA056915, TA056916, TA056917, TA056918, TA056919, TA056920, TA056921, TA056922, TA056923, TA056925 309725..399516 0.005 View NZ_CP013302 Vibrio cholerae strain C5 Integron TA058213, TA058214, TA058215, TA058216, TA058217, TA058218, TA058219, TA058220, TA058221, TA058222, TA058223, TA058224, TA058225, TA058226, TA058227, TA058228, TA058229, TA058230, TA058231, TA058232, TA058233, TA058234, TA058235 309774..468910 0.005 View NZ_CP013306 Vibrio cholerae strain CRC1106 Integron TA058258, TA058259, TA058260, TA058261, TA058262, TA058263, TA058264, TA058265, TA058266, TA058267, TA058268, TA058269, TA058270, TA058271, TA058272, TA058273, TA058274, TA058275, TA058276, TA058277, TA058278, TA058279, TA058280 309821..463174 0.006 View NZ_CP013310 Vibrio cholerae strain E1162 Integron TA058301, TA058302, TA058303, TA058304, TA058305, TA058306, TA058307, TA058308, TA058309, TA058310, TA058311, TA058312, TA058313, TA058314, TA058315, TA058316, TA058317, TA058318, TA058319, TA058320, TA058321, TA058322, TA058323 440614..596283 0.005 View NZ_CP013314 Vibrio cholerae strain E9120 Integron TA058348, TA058349, TA058350, TA058351, TA058352, TA058353, TA058354, TA058355, TA058356, TA058357, TA058358, TA058359, TA058360, TA058361, TA058362, TA058363, TA058364, TA058365, TA058366, TA058367, TA058368, TA058369, TA058370 309780..468088 0.005 View NZ_CP013316 Vibrio cholerae strain M2140 Integron TA058372, TA058373, TA058374, TA058375, TA058376, TA058377, TA058378, TA058379, TA058380, TA058381, TA058382, TA058383, TA058384, TA058385, TA058386, TA058387, TA058388, TA058389 93061..221594 0.008 View NZ_CP013318 Vibrio cholerae strain NCTC5395 Integron TA058391, TA058392, TA058393, TA058394, TA058395, TA058396, TA058397, TA058398, TA058399, TA058400, TA058401, TA058402, TA058403, TA058404, TA058405, TA058406, TA058407, TA058408, TA058409, TA058410, TA058411 343365..496457 0.009 View NZ_CP020407 Vibrio cholerae strain FDAARGOS_223 Integron TA074614, TA074615, TA074616, TA074617, TA074618, TA074619, TA074620, TA074621, TA074622, TA074623, TA074624, TA074625, TA074626, TA074627, TA074628, TA074629, TA074630, TA074631 749463..875103 0 View NZ_CP024163 Vibrio cholerae strain E7946 Integron TA087016, TA087017, TA087018, TA087019, TA087020, TA087021, TA087022, TA087023, TA087024, TA087025, TA087026, TA087027, TA087028, TA087029, TA087030, TA087031, TA087032, TA087033 309306..433568 0 View NZ_CP024868 Vibrio cholerae strain A1552 Integron TA088996, TA088997, TA088987, TA088988, TA088989, TA088990, TA088991, TA088992, TA088993, TA088994, TA088995, TA088998, TA088999, TA089000, TA089001, TA089002, TA089003, TA089004 309797..433602 0 View NZ_CP025937 Vibrio cholerae strain A1552 Integron TA092502, TA092503, TA092504, TA092505, TA092506, TA092507, TA092508, TA092509, TA092510, TA092511, TA092512, TA092513, TA092514, TA092515, TA092516, TA092517, TA092518, TA092519 309147..432952 0 View NZ_CP026648 Vibrio cholerae O1 biovar El Tor strain HC1037 Integron TA095391, TA095375, TA095376, TA095377, TA095378, TA095379, TA095380, TA095381, TA095382, TA095383, TA095384, TA095385, TA095386, TA095387, TA095388, TA095389, TA095390, TA095392 36123..135858 0.004 View NZ_CP028828 Vibrio cholerae strain N16961 Integron TA104260, TA104261, TA104247, TA104248, TA104249, TA104250, TA104251, TA104252, TA104253, TA104254, TA104255, TA104256, TA104257, TA104258, TA104259, TA104262, TA104263, TA104264 312057..437697 0 View NZ_CP028895 Vibrio cholerae strain A1552 Integron TA104335, TA104336, TA104337, TA104338, TA104339, TA104340, TA104341, TA104342, TA104343, TA104344, TA104345, TA104346, TA104347, TA104348, TA104349, TA104350, TA104351, TA104352 311994..435799 0 View NZ_CP033513 Vibrio cholerae strain E4 Integron TA113805, TA113806, TA113807, TA113808, TA113794, TA113795, TA113796, TA113797, TA113798, TA113799, TA113800, TA113801, TA113802, TA113803, TA113804, TA113809, TA113810, TA113811 127139..226875 0.004 View NZ_CP040173 Vibrio cholerae strain VC1374 Integron TA125036, TA125037, TA125038, TA125039, TA125040, TA125041, TA125042, TA125043, TA125044, TA125045, TA125046, TA125047, TA125048, TA125049, TA125050, TA125051, TA125052 887669..977464 0.005 View NZ_CP046841 Vibrio cholerae strain F9993 Integron TA145056, TA145057, TA145058, TA145059, TA145060, TA145061, TA145062, TA145063, TA145064, TA145065, TA145066, TA145067, TA145068, TA145069, TA145070, TA145071, TA145072 322432..412236 0.005 View NZ_CP047060 Vibrio cholerae isolate CTMA_1441 Integron TA145398, TA145399, TA145392, TA145393, TA145394, TA145395, TA145396, TA145397, TA145400, TA145401, TA145402, TA145403, TA145404, TA145405, TA145406, TA145407, TA145408, TA145409 311040..410783 0.004 View NZ_CP047296 Vibrio cholerae C6706 Integron TA145820, TA145815, TA145816, TA145817, TA145818, TA145819, TA145803, TA145804, TA145805, TA145806, TA145807, TA145808, TA145809, TA145810, TA145811, TA145812, TA145813, TA145814, TA145821 311985..435789 0 View NZ_CP047298 Vibrio cholerae O1 biovar El Tor strain C6709 Integron TA145823, TA145824, TA145825, TA145826, TA145827, TA145828, TA145829, TA145830, TA145831, TA145832, TA145833, TA145834, TA145835, TA145836, TA145837, TA145838, TA145839, TA145840, TA145841 311981..435786 0 View NZ_CP047300 Vibrio cholerae O1 biovar El Tor strain P27459 Integron TA145843, TA145844, TA145845, TA145846, TA145847, TA145848, TA145849, TA145850, TA145851, TA145852, TA145853, TA145854, TA145855, TA145856, TA145857, TA145858, TA145859, TA145860, TA145861 312006..438916 0 View NZ_CP047302 Vibrio cholerae O1 biovar El Tor strain DRC-193A Integron TA145864, TA145865, TA145866, TA145867, TA145868, TA145869, TA145870, TA145871, TA145872, TA145873, TA145874, TA145875, TA145876, TA145877, TA145878, TA145879, TA145880, TA145881 311015..410760 0.004 View NZ_CP047304 Vibrio cholerae O1 biovar El Tor strain E7946 Integron TA145883, TA145884, TA145885, TA145886, TA145887, TA145888, TA145889, TA145890, TA145891, TA145892, TA145893, TA145894, TA145895, TA145896, TA145897, TA145898, TA145899, TA145900, TA145901 312112..436375 0 View NZ_CP064351 Vibrio cholerae C6706 Integron TA180865, TA180866, TA180867, TA180868, TA180869, TA180870, TA180871, TA180872, TA180873, TA180874, TA180875, TA180876, TA180877, TA180878, TA180879, TA180880, TA180881, TA180882 378284..502088 0 View NZ_CP072848 Vibrio cholerae strain A1552 Integron TA198989, TA198978, TA198979, TA198980, TA198981, TA198982, TA198983, TA198984, TA198985, TA198986, TA198987, TA198988, TA198990, TA198991, TA198992, TA198993, TA198994 311994..435799 0 View NZ_CP072850 Vibrio cholerae MO10 Integron TA198998, TA198999, TA199000, TA199001, TA199002, TA199003, TA199004, TA199005, TA199006, TA199007, TA199008, TA199009, TA199010, TA199011, TA199012, TA199013 312008..401813 0.005 View NZ_CP080466 Vibrio cholerae strain ICDC-VC3741 Integron TA211906, TA211907, TA211908, TA211909, TA211910, TA211911, TA211912, TA211913, TA211914, TA211915, TA211916, TA211917, TA211918, TA211919, TA211920, TA211921, TA211922 933056..1032792 0.004 View NZ_CP090379 Vibrio cholerae strain BY369 Integron TA230515, TA230516, TA230517, TA230518, TA230519, TA230520, TA230521, TA230522, TA230523, TA230524, TA230525, TA230526, TA230527, TA230528, TA230529, TA230530 309725..399516 0.005 View NZ_CP090400 Vibrio cholerae strain PanChol Integron TA230635, TA230636, TA230637, TA230638, TA230639, TA230640, TA230641, TA230642, TA230643, TA230644, TA230645, TA230646, TA230647, TA230648, TA230649, TA230650, TA230651 836019..937068 0.004 View NZ_CP102928 Vibrio cholerae strain N1252 Integron TA254465, TA254466, TA254467, TA254468, TA254469, TA254470, TA254471, TA254472, TA254473, TA254474, TA254475, TA254476, TA254477, TA254478, TA254479, TA254480, TA254481 718932..819981 0.004 View NZ_LT906615 Vibrio cholerae O1 biovar El Tor str. N16961 Integron TA293792, TA293793, TA293794, TA293795, TA293796, TA293797, TA293798, TA293799, TA293800, TA293801, TA293802, TA293803, TA293804, TA293805, TA293806, TA293807, TA293808, TA293809 309746..435385 0 View NZ_LT907990 Vibrio cholerae strain A19 Integron TA293821, TA293822, TA293823, TA293824, TA293825, TA293826, TA293827, TA293828, TA293829, TA293830, TA293831, TA293832, TA293833, TA293834, TA293835, TA293836, TA293837, TA293838 309746..435385 0 View NZ_LT992487 Vibrio cholerae strain 4295STDY6534216 Integron TA294348, TA294349, TA294350, TA294351, TA294352, TA294353, TA294354, TA294355, TA294356, TA294357, TA294358, TA294359, TA294360, TA294361, TA294362, TA294363, TA294364 897901..987709 0.005 View NZ_LT992489 Vibrio cholerae strain 4295STDY6534232 Integron TA294368, TA294369, TA294370, TA294371, TA294372, TA294373, TA294374, TA294375, TA294376, TA294377, TA294378, TA294379, TA294380, TA294381, TA294382, TA294383, TA294384 379701..469509 0.005 View NZ_LT992493 Vibrio cholerae strain 4295STDY6534248 Integron TA294406, TA294407, TA294408, TA294409, TA294410, TA294411, TA294412, TA294413, TA294414, TA294415, TA294416, TA294417, TA294418, TA294419, TA294420, TA294421, TA294422 202848..292656 0.005 View NZ_OW443148 Vibrio cholerae strain CNRVC190243 isolate YE-NCPHL-19014-PI Integron TA295386, TA295387, TA295388, TA295389, TA295390, TA295391, TA295392, TA295393, TA295394, TA295395, TA295396, TA295397, TA295398, TA295399, TA295400, TA295401, TA295402 354985..456034 0.004	inside	Integron	catB9	-	309750..435387	125637

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Toxin HigB-1 (2-95)

Antitoxin

• Cro/C1-type helix-turn-helix domain (12-69)

Sequences

Toxin

Protein

• Length: 96 a.a.
• Molecular weight: 11349.95 Da
• Isoelectric Point: 6.7187

>T171 WP_001162670.1 NC_002506:369426-369713 [Vibrio cholerae O1 biovar El Tor str. N16961]
MALEFKDKWLEQFYEDDKRHRLIPSSIENALFRKLEILDAAQAESDLRIPPGNRFEHLEGNLKGWCSIRVNKQYRLIFQW
VDGVALNTYLDPHKY

Nucleotide

• Length: 288 bp

>T171 NC_002506:369426-369713 [Vibrio cholerae O1 biovar El Tor str. N16961]
ATGGCATTAGAATTTAAAGATAAGTGGTTAGAGCAGTTTTACGAGGATGATAAACGACATCGTTTAATTCCAAGTAGCAT
AGAGAATGCTCTATTTCGGAAGCTGGAAATCTTAGATGCAGCTCAAGCTGAATCAGACTTAAGAATTCCACCGGGTAATC
GTTTTGAACATCTTGAAGGAAATCTTAAAGGTTGGTGTTCAATTCGAGTGAACAAACAGTATCGTTTGATTTTTCAGTGG
GTTGATGGTGTTGCACTAAATACTTACTTAGACCCACATAAGTATTGA

Antitoxin

Protein

• Length: 106 a.a.
• Molecular weight: 11705.63 Da
• Isoelectric Point: 10.4711

>AT171 WP_001232701.1 NC_002506:369724-370041 [Vibrio cholerae O1 biovar El Tor str. N16961]
MRKTKRRPVSVGEMLKVEFLEPMGITSKALAEAMGVHRNTVSNLINGGVLTAPVAIKLAAALGNTPEFWLNIQHAVDLWD
TRNRYQEEAKFVKPLFVSLEQSART

Nucleotide

• Length: 318 bp

>AT171 NC_002506:369724-370041 [Vibrio cholerae O1 biovar El Tor str. N16961]
ATGCGTAAGACAAAACGTCGTCCAGTTAGCGTTGGGGAAATGTTAAAAGTTGAATTTCTTGAACCAATGGGCATCACATC
AAAAGCGCTCGCTGAAGCGATGGGCGTACACAGAAATACGGTCAGTAATTTAATTAATGGTGGTGTGTTAACAGCTCCGG
TAGCAATCAAGTTAGCCGCGGCATTAGGTAACACACCAGAATTTTGGCTTAACATTCAACATGCAGTTGATCTTTGGGAT
ACGAGAAATCGTTATCAAGAAGAAGCAAAGTTTGTAAAGCCGTTGTTTGTTTCGCTGGAACAAAGCGCACGTACATAA

Similar Proteins

Only experimentally validated proteins are listed.

Toxin

Loading, please wait

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
T6124	Haemophilus influenzae 86-028NP	46.154	95.789	0.442
T6083	Pseudomonas putida KT2440	41.111	97.826	0.402
T10032	Pseudomonas aeruginosa PAO1	40.964	90.217	0.37
T10161	Pseudomonas aeruginosa PA14 strain MA3 isolate DTU_MIE	40.964	90.217	0.37

Showing 1 to 4 of 4 rows

10

rows per page

• ‹
• 1
• ›

Multiple sequence alignment

Antitoxin

Loading, please wait

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
AT6124	Haemophilus influenzae 86-028NP	47.826	87.619	0.419
AT6083	Pseudomonas putida KT2440	43.333	90.909	0.394
AT6146	Proteus vulgaris	44.595	71.154	0.317

Showing 1 to 3 of 3 rows

10

rows per page

• ‹
• 1
• ›

Multiple sequence alignment

Structures

Toxin

Loading, please wait

• AlphaFold DB: A0A0F2HI36

Antitoxin

Loading, please wait

Source	ID	Structure
No matching records found

References

(1) Naeem Iqbal et al. (2015) Comprehensive Functional Analysis of the 18 Vibrio cholerae N16961 Toxin-Antitoxin Systems Substantiates Their Role in Stabilizing the Superintegron. Journal of Bacteriology 197(13):2150-9. [PubMed:25897030]


 experimental literature