Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/RelE-MqsA |
Location | 435596..436229 | Replicon | chromosome |
Accession | NZ_OW443148 | ||
Organism | Vibrio cholerae strain CNRVC190243 isolate YE-NCPHL-19014-PI |
Toxin (Protein)
Gene name | higB | Uniprot ID | Q9KMA6 |
Locus tag | OC617_RS16175 | Protein ID | WP_000843587.1 |
Coordinates | 435596..435928 (+) | Length | 111 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | OC617_RS16180 | Protein ID | WP_000071008.1 |
Coordinates | 435915..436229 (+) | Length | 105 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OC617_RS16115 | 430831..430896 | + | 66 | Protein_445 | acetyltransferase | - |
OC617_RS16120 | 431037..431240 | + | 204 | WP_001911745.1 | hypothetical protein | - |
OC617_RS16125 | 431497..431694 | + | 198 | WP_001894451.1 | DUF3709 domain-containing protein | - |
OC617_RS16130 (CNRVC190243H_03167) | 432054..432323 | + | 270 | WP_001198131.1 | hypothetical protein | - |
OC617_RS16135 | 432659..432812 | + | 154 | Protein_449 | DUF645 family protein | - |
OC617_RS16140 (CNRVC190243H_03168) | 433021..433407 | + | 387 | WP_000703163.1 | VOC family protein | - |
OC617_RS16145 (CNRVC190243H_03169) | 433492..433851 | + | 360 | WP_226979446.1 | pullulanase | - |
OC617_RS16150 (CNRVC190243H_03170) | 434022..434399 | + | 378 | WP_000411109.1 | hypothetical protein | - |
OC617_RS16155 | 434456..434570 | + | 115 | Protein_453 | acetyltransferase | - |
OC617_RS16160 (CNRVC190243H_03171) | 434579..434800 | + | 222 | WP_032468461.1 | DUF1289 domain-containing protein | - |
OC617_RS16165 | 434966..435079 | + | 114 | WP_001889158.1 | hypothetical protein | - |
OC617_RS16170 | 435028..435255 | + | 228 | WP_073426587.1 | DUF1289 domain-containing protein | - |
OC617_RS16175 (CNRVC190243H_03172) | 435596..435928 | + | 333 | WP_000843587.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
OC617_RS16180 (CNRVC190243H_03173) | 435915..436229 | + | 315 | WP_000071008.1 | DNA-binding transcriptional regulator | Antitoxin |
OC617_RS16185 (CNRVC190243H_03174) | 436366..436800 | + | 435 | WP_000256036.1 | GNAT family N-acetyltransferase | - |
OC617_RS16190 (CNRVC190243H_03175) | 436968..437123 | + | 156 | WP_000751734.1 | hypothetical protein | - |
OC617_RS16195 (CNRVC190243H_03176) | 437248..438228 | - | 981 | WP_000019370.1 | IS5-like element ISVch5 family transposase | - |
OC617_RS16200 (CNRVC190243H_03177) | 438296..438602 | + | 307 | Protein_462 | CatB-related O-acetyltransferase | - |
OC617_RS16205 | 438739..439137 | + | 399 | Protein_463 | GNAT family N-acetyltransferase | - |
OC617_RS16210 | 439261..439431 | + | 171 | WP_001080654.1 | hypothetical protein | - |
OC617_RS16215 (CNRVC190243H_03179) | 439431..439832 | + | 402 | WP_000351248.1 | type II toxin-antitoxin system death-on-curing family toxin | - |
OC617_RS16220 | 439835..439945 | + | 111 | WP_082798255.1 | DUF3265 domain-containing protein | - |
OC617_RS16225 (CNRVC190243H_03180) | 440020..440433 | + | 414 | WP_000049417.1 | VOC family protein | - |
OC617_RS16230 (CNRVC190243H_03181) | 440647..440898 | + | 252 | WP_001250179.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | - |
OC617_RS16235 (CNRVC190243H_03182) | 440888..441175 | + | 288 | WP_000221354.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | catB9 | - | 349905..456410 | 106505 | |
inside | Integron | catB9 | - | 354985..456034 | 101049 | ||
flank | IS/Tn | - | - | 437248..438228 | 980 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 111 a.a. Molecular weight: 13005.95 Da Isoelectric Point: 9.9244
>T295395 WP_000843587.1 NZ_OW443148:435596-435928 [Vibrio cholerae]
MKSVFVESTIFEKYRDEYLSDEEYRLFQAELMLNPKLGDVIQGTGGLRKIRVASKGKGKRGGSRIIYYFLDEKRRFYLLT
IYGKNEMSDLNANQRKQLMAFMEAWRNEQS
MKSVFVESTIFEKYRDEYLSDEEYRLFQAELMLNPKLGDVIQGTGGLRKIRVASKGKGKRGGSRIIYYFLDEKRRFYLLT
IYGKNEMSDLNANQRKQLMAFMEAWRNEQS
Download Length: 333 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|