293792

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) parDE/ParE-Phd
Location 322682..323260 Replicon chromosome
Accession NZ_LT906615
Organism Vibrio cholerae O1 biovar El Tor str. N16961

Toxin (Protein)


Gene name parE Uniprot ID O68848
Locus tag FY484_RS15340 Protein ID WP_001180243.1
Coordinates 322682..322999 (-) Length 106 a.a.

Antitoxin (Protein)


Gene name parD Uniprot ID Q7DCR7
Locus tag FY484_RS15345 Protein ID WP_000557292.1
Coordinates 323018..323260 (-) Length 81 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
FY484_RS15300 318206..318388 + 183 WP_000923340.1 DUF645 family protein -
FY484_RS15305 318742..318924 + 183 WP_000923153.1 DUF645 family protein -
FY484_RS15315 319119..319796 + 678 WP_000254617.1 HNH endonuclease -
FY484_RS15320 319958..321166 + 1209 WP_000272282.1 deoxyguanosinetriphosphate triphosphohydrolase family protein -
FY484_RS15325 321328..322032 + 705 WP_000087610.1 HNH endonuclease -
FY484_RS15330 322190..322528 + 339 WP_000713853.1 hypothetical protein -
FY484_RS15340 322682..322999 - 318 WP_001180243.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
FY484_RS15345 323018..323260 - 243 WP_000557292.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
FY484_RS15350 323504..323890 + 387 WP_001015867.1 NUDIX hydrolase -
FY484_RS15355 323947..324060 + 114 WP_001900214.1 hypothetical protein -
FY484_RS15360 324009..324290 + 282 WP_001894429.1 DUF1289 domain-containing protein -
FY484_RS15375 324548..325084 + 537 WP_000469482.1 GNAT family N-acetyltransferase -
FY484_RS15380 325221..325736 + 516 WP_001201509.1 lipocalin family protein -
FY484_RS15385 325886..326383 - 498 WP_000982260.1 GNAT family N-acetyltransferase -
FY484_RS15390 326380..326652 - 273 WP_000246253.1 DUF1778 domain-containing protein -
FY484_RS15395 327045..327170 + 126 WP_001900195.1 DUF645 family protein -
FY484_RS15400 327186..327224 + 39 WP_106019118.1 hypothetical protein -
FY484_RS15410 327420..327866 + 447 WP_000006157.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Genomic island catB9 - 304666..435761 131095
inside Integron catB9 - 309746..435385 125639


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(6-93)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-71)


Sequences

Toxin        


Download         Length: 106 a.a.        Molecular weight: 12158.97 Da        Isoelectric Point: 9.7495

>T293792 WP_001180243.1 NZ_LT906615:c322999-322682 [Vibrio cholerae O1 biovar El Tor str. N16961]
MQNKQYKLSQLAQEHLLKIKHYTIENFAEAQWQKYKSTLLSGFQTLADNPGLGKSCEDIYQNGFYFPVGKHMAYYTKEAN
FILIVAVLGQSQLPQKHLKQSRFVS

Download         Length: 318 bp

Antitoxin


Download         Length: 81 a.a.        Molecular weight: 8961.25 Da        Isoelectric Point: 5.6630

>AT293792 WP_000557292.1 NZ_LT906615:c323260-323018 [Vibrio cholerae O1 biovar El Tor str. N16961]
MHTLTANDAKRNFGELLLSAQREPVIISKNSKNTVVVMSIKDFEELEAMKLDYLKHCFESAQKDLDSGKTVDGATFLNTL

Download         Length: 243 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0K9UJR8

Antitoxin

Source ID Structure
AlphaFold DB Q7DCR7

References