295387

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) /GNAT-DUF1778
Location 369749..370515 Replicon chromosome
Accession NZ_OW443148
Organism Vibrio cholerae strain CNRVC190243 isolate YE-NCPHL-19014-PI

Toxin (Protein)


Gene name - Uniprot ID Q9K2P7
Locus tag OC617_RS15510 Protein ID WP_000982260.1
Coordinates 369749..370246 (-) Length 166 a.a.

Antitoxin (Protein)


Gene name - Uniprot ID Q9K2J6
Locus tag OC617_RS15515 Protein ID WP_000246253.1
Coordinates 370243..370515 (-) Length 91 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OC617_RS15460 (CNRVC190243H_03080) 365191..365895 + 705 WP_000087610.1 HNH endonuclease -
OC617_RS15465 (CNRVC190243H_03081) 366053..366391 + 339 WP_000713853.1 hypothetical protein -
OC617_RS15470 (CNRVC190243H_03082) 366545..366862 - 318 WP_001180243.1 type II toxin-antitoxin system RelE/ParE family toxin -
OC617_RS15475 (CNRVC190243H_03083) 366881..367123 - 243 WP_000557292.1 type II toxin-antitoxin system Phd/YefM family antitoxin -
OC617_RS15480 (CNRVC190243H_03084) 367367..367753 + 387 WP_001015867.1 NUDIX hydrolase -
OC617_RS15485 367810..367923 + 114 WP_001900214.1 hypothetical protein -
OC617_RS15490 (CNRVC190243H_03085) 367932..368153 + 222 WP_032467793.1 DUF1289 domain-containing protein -
OC617_RS15495 (CNRVC190243H_03086) 368411..368947 + 537 WP_000469482.1 GNAT family protein -
OC617_RS15500 (CNRVC190243H_03087) 369138..369599 + 462 WP_001903091.1 lipocalin family protein -
OC617_RS15505 369664..369732 + 69 Protein_323 acetyltransferase -
OC617_RS15510 (CNRVC190243H_03088) 369749..370246 - 498 WP_000982260.1 GNAT family N-acetyltransferase Toxin
OC617_RS15515 (CNRVC190243H_03089) 370243..370515 - 273 WP_000246253.1 DUF1778 domain-containing protein Antitoxin
OC617_RS15520 370908..371033 + 126 WP_001900195.1 DUF645 family protein -
OC617_RS15525 (CNRVC190243H_03090) 371283..371729 + 447 WP_000006157.1 hypothetical protein -
OC617_RS15530 (CNRVC190243H_03091) 371792..373003 + 1212 WP_001122813.1 IS256 family transposase -
OC617_RS15535 (CNRVC190243H_03092) 373190..373459 - 270 WP_000277238.1 type II toxin-antitoxin system YafQ family toxin -
OC617_RS15540 (CNRVC190243H_03093) 373452..373730 - 279 WP_001258569.1 type II toxin-antitoxin system RelB/DinJ family antitoxin -
OC617_RS15545 373781..373898 + 118 Protein_331 DUF3265 domain-containing protein -
OC617_RS15550 374016..374294 + 279 WP_001921601.1 DUF3709 domain-containing protein -
OC617_RS15555 374654..374752 + 99 WP_223225486.1 DUF3709 domain-containing protein -
OC617_RS15560 374952..375053 + 102 WP_001921603.1 hypothetical protein -
OC617_RS15565 (CNRVC190243H_03094) 375043..375429 + 387 WP_000703163.1 VOC family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Genomic island catB9 - 349905..456410 106505
inside Integron catB9 - 354985..456034 101049
- flank IS/Tn - - 371792..373003 1211


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

GNAT domain

(86-152)

Antitoxin

Vibrio phage ICP1, Orf50

(7-86)


Sequences

Toxin        


Download         Length: 166 a.a.        Molecular weight: 18527.18 Da        Isoelectric Point: 8.7753

>T295387 WP_000982260.1 NZ_OW443148:c370246-369749 [Vibrio cholerae]
MMNTVLLDKDKHDRNRFNCGTEALNNYLKVMASQQAKKDNTRTFVLEDDNNSAYIIGFYTLTMTPIDLKALPDKLQKKHQ
SSTSGGLIARLAVDDRYKGKGFGEWLLIDALRKLLAASDSVAFPVVIVDAKDGAKHFYERYGFQAFQDAENKLFITIADI
RASLG

Download         Length: 498 bp

Antitoxin


Download         Length: 91 a.a.        Molecular weight: 9683.22 Da        Isoelectric Point: 6.2988

>AT295387 WP_000246253.1 NZ_OW443148:c370515-370243 [Vibrio cholerae]
MATTLPRITARVDVDTQDLLAKAAALAGMSSINSFVLNAAIEKAKQVIEREQALKLSQADAVLLMEALDNPAVVNAKLKL
ASERYESKTQ

Download         Length: 273 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0Q0KGB1

Antitoxin

Source ID Structure
AlphaFold DB A0A0F2IC79

References