294412

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) higBA (relBE)/HigB-HigA
Location 251218..251833 Replicon chromosome
Accession NZ_LT992493
Organism Vibrio cholerae strain 4295STDY6534248

Toxin (Protein)


Gene name higB Uniprot ID Q9KMG5
Locus tag DG169_RS15810 Protein ID WP_001162670.1
Coordinates 251218..251505 (+) Length 96 a.a.

Antitoxin (Protein)


Gene name higA Uniprot ID -
Locus tag DG169_RS15815 Protein ID WP_001232701.1
Coordinates 251516..251833 (+) Length 106 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
DG169_RS19830 246854..246949 + 96 WP_001907607.1 DUF645 family protein -
DG169_RS15770 247143..247460 - 318 WP_001180243.1 type II toxin-antitoxin system RelE/ParE family toxin -
DG169_RS15775 247479..247721 - 243 WP_000557292.1 type II toxin-antitoxin system Phd/YefM family antitoxin -
DG169_RS15780 247963..248472 + 510 WP_000405987.1 GNAT family N-acetyltransferase -
DG169_RS15785 248529..249182 + 654 WP_000226874.1 hypothetical protein -
DG169_RS15790 249492..249710 + 219 WP_001917086.1 DUF3709 domain-containing protein -
DG169_RS15795 250113..250346 + 234 WP_032482776.1 DUF3709 domain-containing protein -
DG169_RS15800 250771..250951 + 181 Protein_262 DUF645 family protein -
DG169_RS15810 251218..251505 + 288 WP_001162670.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
DG169_RS15815 251516..251833 + 318 WP_001232701.1 HigA family addiction module antidote protein Antitoxin
DG169_RS19835 251830..251940 + 111 WP_134814058.1 DUF3265 domain-containing protein -
DG169_RS19840 252117..252242 + 126 WP_001944767.1 DUF645 family protein -
DG169_RS19845 252258..252296 + 39 WP_106019119.1 hypothetical protein -
DG169_RS15840 252509..253513 + 1005 WP_000964925.1 LD-carboxypeptidase -
DG169_RS15845 253666..254112 + 447 WP_000128977.1 hypothetical protein -
DG169_RS15850 254232..255161 + 930 WP_000335802.1 hypothetical protein -
DG169_RS15855 255158..255268 + 111 WP_071917832.1 DUF3265 domain-containing protein -
DG169_RS15860 255296..255772 + 477 WP_001047180.1 GNAT family N-acetyltransferase -
DG169_RS15865 255909..256424 + 516 WP_001201528.1 lipocalin family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Genomic island catB9 - 197768..293032 95264
inside Integron catB9 - 202848..292656 89808


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin HigB-1

(2-95)

Antitoxin

Cro/C1-type helix-turn-helix domain

(12-69)


Sequences

Toxin        


Download         Length: 96 a.a.        Molecular weight: 11349.95 Da        Isoelectric Point: 6.7187

>T294412 WP_001162670.1 NZ_LT992493:251218-251505 [Vibrio cholerae]
MALEFKDKWLEQFYEDDKRHRLIPSSIENALFRKLEILDAAQAESDLRIPPGNRFEHLEGNLKGWCSIRVNKQYRLIFQW
VDGVALNTYLDPHKY

Download         Length: 288 bp

Antitoxin


Download         Length: 106 a.a.        Molecular weight: 11705.63 Da        Isoelectric Point: 10.4711

>AT294412 WP_001232701.1 NZ_LT992493:251516-251833 [Vibrio cholerae]
MRKTKRRPVSVGEMLKVEFLEPMGITSKALAEAMGVHRNTVSNLINGGVLTAPVAIKLAAALGNTPEFWLNIQHAVDLWD
TRNRYQEEAKFVKPLFVSLEQSART

Download         Length: 318 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0F2HI36

Antitoxin

Source ID Structure

References