Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | parDE/ParE-Phd |
Location | 47682..48260 | Replicon | chromosome |
Accession | NZ_CP026648 | ||
Organism | Vibrio cholerae O1 biovar El Tor strain HC1037 |
Toxin (Protein)
Gene name | parE | Uniprot ID | O68848 |
Locus tag | C4E16_RS14380 | Protein ID | WP_001180243.1 |
Coordinates | 47682..47999 (-) | Length | 106 a.a. |
Antitoxin (Protein)
Gene name | parD | Uniprot ID | Q7DCR7 |
Locus tag | C4E16_RS14385 | Protein ID | WP_000557292.1 |
Coordinates | 48018..48260 (-) | Length | 81 a.a. |
Genomic Context
Location: 43206..43388 (183 bp)
Type: Others
Protein ID: WP_000923340.1
Type: Others
Protein ID: WP_000923340.1
Location: 43742..43924 (183 bp)
Type: Others
Protein ID: WP_000923153.1
Type: Others
Protein ID: WP_000923153.1
Location: 44119..44796 (678 bp)
Type: Others
Protein ID: WP_000254617.1
Type: Others
Protein ID: WP_000254617.1
Location: 44958..46166 (1209 bp)
Type: Others
Protein ID: WP_000272282.1
Type: Others
Protein ID: WP_000272282.1
Location: 46328..47032 (705 bp)
Type: Others
Protein ID: WP_000087610.1
Type: Others
Protein ID: WP_000087610.1
Location: 47190..47528 (339 bp)
Type: Others
Protein ID: WP_000713853.1
Type: Others
Protein ID: WP_000713853.1
Location: 48504..48890 (387 bp)
Type: Others
Protein ID: WP_001015867.1
Type: Others
Protein ID: WP_001015867.1
Location: 48947..49060 (114 bp)
Type: Others
Protein ID: WP_001900214.1
Type: Others
Protein ID: WP_001900214.1
Location: 49009..49290 (282 bp)
Type: Others
Protein ID: WP_001894429.1
Type: Others
Protein ID: WP_001894429.1
Location: 49548..50084 (537 bp)
Type: Others
Protein ID: WP_000469482.1
Type: Others
Protein ID: WP_000469482.1
Location: 50221..50736 (516 bp)
Type: Others
Protein ID: WP_001201509.1
Type: Others
Protein ID: WP_001201509.1
Location: 52045..52170 (126 bp)
Type: Others
Protein ID: WP_001900195.1
Type: Others
Protein ID: WP_001900195.1
Location: 52186..52224 (39 bp)
Type: Others
Protein ID: WP_106019118.1
Type: Others
Protein ID: WP_106019118.1
Location: 52420..52866 (447 bp)
Type: Others
Protein ID: WP_000006157.1
Type: Others
Protein ID: WP_000006157.1
Location: 47682..47999 (318 bp)
Type: Toxin
Protein ID: WP_001180243.1
Type: Toxin
Protein ID: WP_001180243.1
Location: 48018..48260 (243 bp)
Type: Antitoxin
Protein ID: WP_000557292.1
Type: Antitoxin
Protein ID: WP_000557292.1
Location: 50886..51383 (498 bp)
Type: Others
Protein ID: WP_000982260.1
Type: Others
Protein ID: WP_000982260.1
Location: 51380..51652 (273 bp)
Type: Others
Protein ID: WP_000246253.1
Type: Others
Protein ID: WP_000246253.1
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
C4E16_RS14340 | 43206..43388 | + | 183 | WP_000923340.1 | DUF645 family protein | - |
C4E16_RS14345 | 43742..43924 | + | 183 | WP_000923153.1 | DUF645 family protein | - |
C4E16_RS14355 | 44119..44796 | + | 678 | WP_000254617.1 | HNH endonuclease | - |
C4E16_RS14360 | 44958..46166 | + | 1209 | WP_000272282.1 | deoxyguanosinetriphosphate triphosphohydrolase family protein | - |
C4E16_RS14365 | 46328..47032 | + | 705 | WP_000087610.1 | HNH endonuclease | - |
C4E16_RS14370 | 47190..47528 | + | 339 | WP_000713853.1 | hypothetical protein | - |
C4E16_RS14380 | 47682..47999 | - | 318 | WP_001180243.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
C4E16_RS14385 | 48018..48260 | - | 243 | WP_000557292.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
C4E16_RS14390 | 48504..48890 | + | 387 | WP_001015867.1 | NUDIX hydrolase | - |
C4E16_RS14395 | 48947..49060 | + | 114 | WP_001900214.1 | hypothetical protein | - |
C4E16_RS14400 | 49009..49290 | + | 282 | WP_001894429.1 | DUF1289 domain-containing protein | - |
C4E16_RS14415 | 49548..50084 | + | 537 | WP_000469482.1 | GNAT family N-acetyltransferase | - |
C4E16_RS14420 | 50221..50736 | + | 516 | WP_001201509.1 | lipocalin family protein | - |
C4E16_RS14425 | 50886..51383 | - | 498 | WP_000982260.1 | GNAT family N-acetyltransferase | - |
C4E16_RS14430 | 51380..51652 | - | 273 | WP_000246253.1 | DUF1778 domain-containing protein | - |
C4E16_RS14435 | 52045..52170 | + | 126 | WP_001900195.1 | DUF645 family protein | - |
C4E16_RS19415 | 52186..52224 | + | 39 | WP_106019118.1 | hypothetical protein | - |
C4E16_RS14445 | 52420..52866 | + | 447 | WP_000006157.1 | hypothetical protein | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | catB9 | - | 31043..136234 | 105191 | |
inside | Integron | - | - | 36123..135858 | 99735 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 106 a.a. Molecular weight: 12158.97 Da Isoelectric Point: 9.7495
>T95375 WP_001180243.1 NZ_CP026648:c47999-47682 [Vibrio cholerae O1 biovar El Tor]
MQNKQYKLSQLAQEHLLKIKHYTIENFAEAQWQKYKSTLLSGFQTLADNPGLGKSCEDIYQNGFYFPVGKHMAYYTKEAN
FILIVAVLGQSQLPQKHLKQSRFVS
MQNKQYKLSQLAQEHLLKIKHYTIENFAEAQWQKYKSTLLSGFQTLADNPGLGKSCEDIYQNGFYFPVGKHMAYYTKEAN
FILIVAVLGQSQLPQKHLKQSRFVS
Download Length: 318 bp
>T95375 NZ_CP026648:c47999-47682 [Vibrio cholerae O1 biovar El Tor]
ATGCAAAATAAACAATATAAGCTCAGCCAATTAGCCCAAGAGCACTTACTCAAGATTAAACACTACACCATTGAAAATTT
CGCTGAAGCGCAGTGGCAAAAATATAAGTCGACCTTGCTTTCAGGTTTCCAAACTCTTGCGGATAACCCAGGACTAGGAA
AAAGCTGTGAAGATATTTACCAAAATGGTTTTTACTTTCCAGTGGGGAAACACATGGCTTATTACACCAAAGAAGCAAAC
TTCATTCTCATTGTTGCGGTATTAGGGCAATCACAACTGCCCCAAAAGCATCTCAAACAGTCACGCTTTGTTTCTTAG
ATGCAAAATAAACAATATAAGCTCAGCCAATTAGCCCAAGAGCACTTACTCAAGATTAAACACTACACCATTGAAAATTT
CGCTGAAGCGCAGTGGCAAAAATATAAGTCGACCTTGCTTTCAGGTTTCCAAACTCTTGCGGATAACCCAGGACTAGGAA
AAAGCTGTGAAGATATTTACCAAAATGGTTTTTACTTTCCAGTGGGGAAACACATGGCTTATTACACCAAAGAAGCAAAC
TTCATTCTCATTGTTGCGGTATTAGGGCAATCACAACTGCCCCAAAAGCATCTCAAACAGTCACGCTTTGTTTCTTAG
Antitoxin
Download Length: 81 a.a. Molecular weight: 8961.25 Da Isoelectric Point: 5.6630
>AT95375 WP_000557292.1 NZ_CP026648:c48260-48018 [Vibrio cholerae O1 biovar El Tor]
MHTLTANDAKRNFGELLLSAQREPVIISKNSKNTVVVMSIKDFEELEAMKLDYLKHCFESAQKDLDSGKTVDGATFLNTL
MHTLTANDAKRNFGELLLSAQREPVIISKNSKNTVVVMSIKDFEELEAMKLDYLKHCFESAQKDLDSGKTVDGATFLNTL
Download Length: 243 bp
>AT95375 NZ_CP026648:c48260-48018 [Vibrio cholerae O1 biovar El Tor]
ATGCACACACTAACAGCAAATGATGCTAAACGAAATTTTGGTGAACTTCTTCTAAGCGCACAACGCGAACCTGTCATCAT
CAGCAAAAACAGTAAGAATACTGTCGTTGTCATGTCCATTAAGGACTTTGAAGAACTTGAAGCAATGAAACTCGATTATC
TCAAACACTGCTTTGAGTCTGCTCAGAAAGACTTAGATAGTGGCAAAACCGTTGATGGTGCCACTTTTCTAAACACCCTT
TGA
ATGCACACACTAACAGCAAATGATGCTAAACGAAATTTTGGTGAACTTCTTCTAAGCGCACAACGCGAACCTGTCATCAT
CAGCAAAAACAGTAAGAATACTGTCGTTGTCATGTCCATTAAGGACTTTGAAGAACTTGAAGCAATGAAACTCGATTATC
TCAAACACTGCTTTGAGTCTGCTCAGAAAGACTTAGATAGTGGCAAAACCGTTGATGGTGCCACTTTTCTAAACACCCTT
TGA
Structures
Toxin
Loading, please wait
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0K9UJR8 |
Antitoxin
Loading, please wait
Source | ID | Structure |
---|---|---|
AlphaFold DB | Q7DCR7 |