Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | /BrnT(toxin) |
Location | 332625..333123 | Replicon | chromosome |
Accession | NZ_CP024868 | ||
Organism | Vibrio cholerae strain A1552 |
Toxin (Protein)
Gene name | - | Uniprot ID | Q9KMK7 |
Locus tag | VCA1552_RS15865 | Protein ID | WP_000589156.1 |
Coordinates | 332625..332891 (+) | Length | 89 a.a. |
Antitoxin (Protein)
Gene name | - | Uniprot ID | Q9KMK6 |
Locus tag | VCA1552_RS15870 | Protein ID | WP_000643598.1 |
Coordinates | 332878..333123 (+) | Length | 82 a.a. |
Genomic Context
Location: 328045..328251 (207 bp)
Type: Others
Protein ID: Protein_290
Type: Others
Protein ID: Protein_290
Location: 328451..328552 (102 bp)
Type: Others
Protein ID: WP_001921603.1
Type: Others
Protein ID: WP_001921603.1
Location: 328542..328928 (387 bp)
Type: Others
Protein ID: WP_000703163.1
Type: Others
Protein ID: WP_000703163.1
Location: 329123..329374 (252 bp)
Type: Others
Protein ID: WP_001890111.1
Type: Others
Protein ID: WP_001890111.1
Location: 329347..329496 (150 bp)
Type: Others
Protein ID: WP_071908333.1
Type: Others
Protein ID: WP_071908333.1
Location: 329588..329830 (243 bp)
Type: Others
Protein ID: WP_000107461.1
Type: Others
Protein ID: WP_000107461.1
Location: 330082..330360 (279 bp)
Type: Others
Protein ID: WP_000280324.1
Type: Others
Protein ID: WP_000280324.1
Location: 330735..330878 (144 bp)
Type: Others
Protein ID: Protein_297
Type: Others
Protein ID: Protein_297
Location: 330932..330970 (39 bp)
Type: Others
Protein ID: WP_082798268.1
Type: Others
Protein ID: WP_082798268.1
Location: 331182..331649 (468 bp)
Type: Others
Protein ID: WP_001289288.1
Type: Others
Protein ID: WP_001289288.1
Location: 331777..332440 (664 bp)
Type: Others
Protein ID: Protein_300
Type: Others
Protein ID: Protein_300
Location: 332625..332891 (267 bp)
Type: Toxin
Protein ID: WP_000589156.1
Type: Toxin
Protein ID: WP_000589156.1
Location: 332878..333123 (246 bp)
Type: Antitoxin
Protein ID: WP_000643598.1
Type: Antitoxin
Protein ID: WP_000643598.1
Location: 333219..334013 (795 bp)
Type: Others
Protein ID: WP_001911581.1
Type: Others
Protein ID: WP_001911581.1
Location: 334116..334244 (129 bp)
Type: Others
Protein ID: WP_071908338.1
Type: Others
Protein ID: WP_071908338.1
Location: 334305..334487 (183 bp)
Type: Others
Protein ID: WP_000923182.1
Type: Others
Protein ID: WP_000923182.1
Location: 334703..335707 (1005 bp)
Type: Others
Protein ID: WP_000964920.1
Type: Others
Protein ID: WP_000964920.1
Location: 335860..336219 (360 bp)
Type: Others
Protein ID: WP_001071541.1
Type: Others
Protein ID: WP_001071541.1
Location: 336492..336725 (234 bp)
Type: Others
Protein ID: WP_001890112.1
Type: Others
Protein ID: WP_001890112.1
Location: 336993..337499 (507 bp)
Type: Others
Protein ID: WP_000393074.1
Type: Others
Protein ID: WP_000393074.1
Location: 337656..338042 (387 bp)
Type: Others
Protein ID: WP_000703163.1
Type: Others
Protein ID: WP_000703163.1
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
VCA1552_RS15805 | 328045..328251 | + | 207 | Protein_290 | DUF3709 domain-containing protein | - |
VCA1552_RS15810 | 328451..328552 | + | 102 | WP_001921603.1 | hypothetical protein | - |
VCA1552_RS15815 | 328542..328928 | + | 387 | WP_000703163.1 | VOC family protein | - |
VCA1552_RS15820 | 329123..329374 | + | 252 | WP_001890111.1 | TIGR03643 family protein | - |
VCA1552_RS15825 | 329347..329496 | + | 150 | WP_071908333.1 | DUF3265 domain-containing protein | - |
VCA1552_RS15830 | 329588..329830 | + | 243 | WP_000107461.1 | hypothetical protein | - |
VCA1552_RS15835 | 330082..330360 | + | 279 | WP_000280324.1 | DUF3709 domain-containing protein | - |
VCA1552_RS19985 | 330735..330878 | + | 144 | Protein_297 | DUF645 family protein | - |
VCA1552_RS19990 | 330932..330970 | + | 39 | WP_082798268.1 | hypothetical protein | - |
VCA1552_RS15850 | 331182..331649 | + | 468 | WP_001289288.1 | OsmC family protein | - |
VCA1552_RS15855 | 331777..332440 | + | 664 | Protein_300 | hypothetical protein | - |
VCA1552_RS15865 | 332625..332891 | + | 267 | WP_000589156.1 | BrnT family toxin | Toxin |
VCA1552_RS15870 | 332878..333123 | + | 246 | WP_000643598.1 | hypothetical protein | Antitoxin |
VCA1552_RS15875 | 333219..334013 | + | 795 | WP_001911581.1 | hypothetical protein | - |
VCA1552_RS19995 | 334116..334244 | + | 129 | WP_071908338.1 | general secretion pathway protein GspI | - |
VCA1552_RS15890 | 334305..334487 | + | 183 | WP_000923182.1 | DUF645 family protein | - |
VCA1552_RS15895 | 334703..335707 | + | 1005 | WP_000964920.1 | LD-carboxypeptidase | - |
VCA1552_RS15900 | 335860..336219 | + | 360 | WP_001071541.1 | VOC family protein | - |
VCA1552_RS15905 | 336492..336725 | + | 234 | WP_001890112.1 | DUF3709 domain-containing protein | - |
VCA1552_RS15910 | 336993..337499 | + | 507 | WP_000393074.1 | hypothetical protein | - |
VCA1552_RS15915 | 337656..338042 | + | 387 | WP_000703163.1 | VOC family protein | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | catB9 | - | 304717..433978 | 129261 | |
inside | Integron | - | - | 309797..433602 | 123805 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 89 a.a. Molecular weight: 10092.34 Da Isoelectric Point: 7.3171
>T88990 WP_000589156.1 NZ_CP024868:332625-332891 [Vibrio cholerae]
MIKFEFDENKSRSNLEKHGIDFHTAQGLWNDSDLIEIPANTSDEPRYLVVGLLNGKHWSGVITYRGTNIRIISVRRSRKA
EVSLYESA
MIKFEFDENKSRSNLEKHGIDFHTAQGLWNDSDLIEIPANTSDEPRYLVVGLLNGKHWSGVITYRGTNIRIISVRRSRKA
EVSLYESA
Download Length: 267 bp
>T88990 NZ_CP024868:332625-332891 [Vibrio cholerae]
ATGATTAAATTTGAATTTGATGAAAACAAAAGCAGAAGTAATCTCGAAAAGCACGGTATTGATTTTCATACAGCTCAAGG
ATTGTGGAATGATTCAGATCTTATCGAGATCCCTGCTAACACGAGTGATGAGCCCAGATATTTGGTTGTCGGCTTACTAA
ACGGTAAGCATTGGTCAGGAGTAATTACCTACCGAGGTACGAATATCAGGATCATCTCAGTTCGGCGTTCACGGAAAGCG
GAGGTAAGCCTTTATGAAAGCGCATGA
ATGATTAAATTTGAATTTGATGAAAACAAAAGCAGAAGTAATCTCGAAAAGCACGGTATTGATTTTCATACAGCTCAAGG
ATTGTGGAATGATTCAGATCTTATCGAGATCCCTGCTAACACGAGTGATGAGCCCAGATATTTGGTTGTCGGCTTACTAA
ACGGTAAGCATTGGTCAGGAGTAATTACCTACCGAGGTACGAATATCAGGATCATCTCAGTTCGGCGTTCACGGAAAGCG
GAGGTAAGCCTTTATGAAAGCGCATGA
Antitoxin
Download Length: 82 a.a. Molecular weight: 9478.77 Da Isoelectric Point: 6.4832
>AT88990 WP_000643598.1 NZ_CP024868:332878-333123 [Vibrio cholerae]
MKAHEFDAKFESDDDDIVMDLDLSQAKRPMHKQKRVNVDFPAWMLESLDREASRIGVTRQSIIKIWLAERLESVSHHSSV
R
MKAHEFDAKFESDDDDIVMDLDLSQAKRPMHKQKRVNVDFPAWMLESLDREASRIGVTRQSIIKIWLAERLESVSHHSSV
R
Download Length: 246 bp
>AT88990 NZ_CP024868:332878-333123 [Vibrio cholerae]
ATGAAAGCGCATGAATTTGATGCCAAGTTTGAAAGTGACGACGATGATATCGTAATGGACTTGGATCTATCGCAAGCTAA
AAGACCGATGCATAAGCAAAAACGAGTCAATGTAGATTTTCCAGCCTGGATGCTTGAGTCCTTGGACAGAGAAGCGAGTC
GTATTGGTGTAACACGTCAATCAATCATTAAAATTTGGCTGGCAGAAAGGTTAGAGAGCGTGTCTCATCATTCAAGTGTG
AGATAA
ATGAAAGCGCATGAATTTGATGCCAAGTTTGAAAGTGACGACGATGATATCGTAATGGACTTGGATCTATCGCAAGCTAA
AAGACCGATGCATAAGCAAAAACGAGTCAATGTAGATTTTCCAGCCTGGATGCTTGAGTCCTTGGACAGAGAAGCGAGTC
GTATTGGTGTAACACGTCAATCAATCATTAAAATTTGGCTGGCAGAAAGGTTAGAGAGCGTGTCTCATCATTCAAGTGTG
AGATAA
Structures
Toxin
Loading, please wait
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A271VMP7 |
Antitoxin
Loading, please wait
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A271VME2 |