Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | relBE/ParE-YafN |
Location | 420412..420940 | Replicon | chromosome |
Accession | NZ_CP072848 | ||
Organism | Vibrio cholerae strain A1552 |
Toxin (Protein)
Gene name | relE | Uniprot ID | A0A0X1KZS6 |
Locus tag | J9265_RS16025 | Protein ID | WP_000221354.1 |
Coordinates | 420653..420940 (+) | Length | 96 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | A0A0X1KZS8 |
Locus tag | J9265_RS16020 | Protein ID | WP_001250179.1 |
Coordinates | 420412..420663 (+) | Length | 84 a.a. |
Genomic Context
Location: 415680..415994 (315 bp)
Type: Others
Protein ID: WP_000071008.1
Type: Others
Protein ID: WP_000071008.1
Location: 416131..416565 (435 bp)
Type: Others
Protein ID: WP_000256036.1
Type: Others
Protein ID: WP_000256036.1
Location: 416733..416888 (156 bp)
Type: Others
Protein ID: WP_000751734.1
Type: Others
Protein ID: WP_000751734.1
Location: 418061..418367 (307 bp)
Type: Others
Protein ID: Protein_471
Type: Others
Protein ID: Protein_471
Location: 418504..418902 (399 bp)
Type: Others
Protein ID: Protein_472
Type: Others
Protein ID: Protein_472
Location: 419026..419196 (171 bp)
Type: Others
Protein ID: WP_001080654.1
Type: Others
Protein ID: WP_001080654.1
Location: 419196..419597 (402 bp)
Type: Others
Protein ID: WP_000351248.1
Type: Others
Protein ID: WP_000351248.1
Location: 419600..419710 (111 bp)
Type: Others
Protein ID: WP_082798255.1
Type: Others
Protein ID: WP_082798255.1
Location: 419785..420198 (414 bp)
Type: Others
Protein ID: WP_000049417.1
Type: Others
Protein ID: WP_000049417.1
Location: 420412..420663 (252 bp)
Type: Antitoxin
Protein ID: WP_001250179.1
Type: Antitoxin
Protein ID: WP_001250179.1
Location: 420653..420940 (288 bp)
Type: Toxin
Protein ID: WP_000221354.1
Type: Toxin
Protein ID: WP_000221354.1
Location: 421068..421523 (456 bp)
Type: Others
Protein ID: WP_001245327.1
Type: Others
Protein ID: WP_001245327.1
Location: 421580..421702 (123 bp)
Type: Others
Protein ID: Protein_480
Type: Others
Protein ID: Protein_480
Location: 421873..421997 (125 bp)
Type: Others
Protein ID: Protein_481
Type: Others
Protein ID: Protein_481
Location: 422114..422182 (69 bp)
Type: Others
Protein ID: Protein_482
Type: Others
Protein ID: Protein_482
Location: 423117..423179 (63 bp)
Type: Others
Protein ID: Protein_485
Type: Others
Protein ID: Protein_485
Location: 423196..423864 (669 bp)
Type: Others
Protein ID: WP_000043871.1
Type: Others
Protein ID: WP_000043871.1
Location: 424016..424303 (288 bp)
Type: Others
Protein ID: WP_000426470.1
Type: Others
Protein ID: WP_000426470.1
Location: 424444..424815 (372 bp)
Type: Others
Protein ID: WP_001164080.1
Type: Others
Protein ID: WP_001164080.1
Location: 425038..425307 (270 bp)
Type: Others
Protein ID: WP_000179600.1
Type: Others
Protein ID: WP_000179600.1
Location: 425304..425837 (534 bp)
Type: Others
Protein ID: WP_000118351.1
Type: Others
Protein ID: WP_000118351.1
Location: 417013..417993 (981 bp)
Type: Others
Protein ID: WP_000019370.1
Type: Others
Protein ID: WP_000019370.1
Location: 422199..422696 (498 bp)
Type: Others
Protein ID: WP_000982260.1
Type: Others
Protein ID: WP_000982260.1
Location: 422693..422965 (273 bp)
Type: Others
Protein ID: WP_000246253.1
Type: Others
Protein ID: WP_000246253.1
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
J9265_RS15975 (J9265_15975) | 415680..415994 | + | 315 | WP_000071008.1 | DNA-binding transcriptional regulator | - |
J9265_RS15980 (J9265_15980) | 416131..416565 | + | 435 | WP_000256036.1 | GNAT family N-acetyltransferase | - |
J9265_RS15985 (J9265_15985) | 416733..416888 | + | 156 | WP_000751734.1 | hypothetical protein | - |
J9265_RS15990 (J9265_15990) | 417013..417993 | - | 981 | WP_000019370.1 | IS5-like element ISVch5 family transposase | - |
J9265_RS15995 (J9265_15995) | 418061..418367 | + | 307 | Protein_471 | CatB-related O-acetyltransferase | - |
J9265_RS19165 | 418504..418902 | + | 399 | Protein_472 | GNAT family N-acetyltransferase | - |
J9265_RS19170 | 419026..419196 | + | 171 | WP_001080654.1 | hypothetical protein | - |
J9265_RS16005 (J9265_16005) | 419196..419597 | + | 402 | WP_000351248.1 | type II toxin-antitoxin system death-on-curing family toxin | - |
J9265_RS16010 (J9265_16010) | 419600..419710 | + | 111 | WP_082798255.1 | DUF3265 domain-containing protein | - |
J9265_RS16015 (J9265_16015) | 419785..420198 | + | 414 | WP_000049417.1 | VOC family protein | - |
J9265_RS16020 (J9265_16020) | 420412..420663 | + | 252 | WP_001250179.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
J9265_RS16025 (J9265_16025) | 420653..420940 | + | 288 | WP_000221354.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
J9265_RS16030 (J9265_16030) | 421068..421523 | + | 456 | WP_001245327.1 | GNAT family N-acetyltransferase | - |
J9265_RS19175 | 421580..421702 | + | 123 | Protein_480 | acetyltransferase | - |
J9265_RS16035 (J9265_16035) | 421873..421997 | + | 125 | Protein_481 | DUF645 family protein | - |
J9265_RS19180 | 422114..422182 | + | 69 | Protein_482 | acetyltransferase | - |
J9265_RS16040 (J9265_16040) | 422199..422696 | - | 498 | WP_000982260.1 | GNAT family N-acetyltransferase | - |
J9265_RS16045 (J9265_16045) | 422693..422965 | - | 273 | WP_000246253.1 | DUF1778 domain-containing protein | - |
J9265_RS19185 | 423117..423179 | + | 63 | Protein_485 | acetyltransferase | - |
J9265_RS16050 (J9265_16050) | 423196..423864 | + | 669 | WP_000043871.1 | hypothetical protein | - |
J9265_RS16055 (J9265_16055) | 424016..424303 | + | 288 | WP_000426470.1 | hypothetical protein | - |
J9265_RS16060 (J9265_16060) | 424444..424815 | + | 372 | WP_001164080.1 | MazG nucleotide pyrophosphohydrolase domain-containing protein | - |
J9265_RS19190 | 425038..425307 | + | 270 | WP_000179600.1 | DUF1778 domain-containing protein | - |
J9265_RS16070 (J9265_16070) | 425304..425837 | + | 534 | WP_000118351.1 | GNAT family N-acetyltransferase | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
inside | Integron | - | - | 311994..435799 | 123805 | ||
flank | IS/Tn | - | - | 417013..417993 | 980 | ||
- | inside | Genomic island | catB9 | - | 306914..436175 | 129261 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 96 a.a. Molecular weight: 10991.96 Da Isoelectric Point: 10.4934
>T198989 WP_000221354.1 NZ_CP072848:420653-420940 [Vibrio cholerae]
MTYKLKFLPAAQKEWSKLAPTIQSQFKKKLKERLENPHVPSAKLRGYDAVYKIKLRTAGYRLAYEVIDDEIVVYVLAVGK
RDKDAVYKKLASRFG
MTYKLKFLPAAQKEWSKLAPTIQSQFKKKLKERLENPHVPSAKLRGYDAVYKIKLRTAGYRLAYEVIDDEIVVYVLAVGK
RDKDAVYKKLASRFG
Download Length: 288 bp
>T198989 NZ_CP097082:326729-327097 [Klebsiella pneumoniae]
ATGACGCTGCAGATTATCTCAGCGGAAGAGATAATACAGTTTCACGACAGGCTGCTCCGCGTCACGCCTGGCGTTGCCGG
TATGCCCGATCTGGGGCGTGCCGAAGCGATAATGTATAGGGTGCTAAACAAAATTGAATATGAAGGTGTGACAGACGTGT
GGCGACTCGCTGCGATGCATCTGCTGGCGATTTCTCGCGGTCATATATTTAATGATGGTAATAAGCGTACGGCACTGTTT
ATCACCCTGCTTTTTTTAAAGCGAAATGGAATTATATTGCCGGCGAATCCAGACTTCGTCGGCATGACCGTCGAGGCAGC
AGCAGGGCAACTTACCCTGGAACAGATTGTCGCGCGTTTGCGTGGATGA
ATGACGCTGCAGATTATCTCAGCGGAAGAGATAATACAGTTTCACGACAGGCTGCTCCGCGTCACGCCTGGCGTTGCCGG
TATGCCCGATCTGGGGCGTGCCGAAGCGATAATGTATAGGGTGCTAAACAAAATTGAATATGAAGGTGTGACAGACGTGT
GGCGACTCGCTGCGATGCATCTGCTGGCGATTTCTCGCGGTCATATATTTAATGATGGTAATAAGCGTACGGCACTGTTT
ATCACCCTGCTTTTTTTAAAGCGAAATGGAATTATATTGCCGGCGAATCCAGACTTCGTCGGCATGACCGTCGAGGCAGC
AGCAGGGCAACTTACCCTGGAACAGATTGTCGCGCGTTTGCGTGGATGA
Antitoxin
Download Length: 84 a.a. Molecular weight: 9136.29 Da Isoelectric Point: 4.0197
>AT198989 WP_001250179.1 NZ_CP072848:420412-420663 [Vibrio cholerae]
MRQVLANCSASISELKKNPTALLNEADGSAIAILNHNKPAAYLVPAETYEYLIDMLDDYELSQIVDSRRADLAQAVEVNI
DDL
MRQVLANCSASISELKKNPTALLNEADGSAIAILNHNKPAAYLVPAETYEYLIDMLDDYELSQIVDSRRADLAQAVEVNI
DDL
Download Length: 252 bp
>AT198989 NZ_CP097082:326511-326732 [Klebsiella pneumoniae]
ATGAGAACGGTTAACTATAGCGAAGCCCGGCAAAATCTGGCCGATGTGCTGGAAAGCGCAGTGACAGGTGTACCTGTGAC
CATTACCCGTCGTGGGCATAAATCTGCAGTCATCATTAGTGCAGAAGAGTTTGAACGCTACCAGGCGGCCAGAATGGATG
ATGAGTTCGCGGCTATCATGGCGGTTCATGGTGATGAGATCAGGGAGCTTGCGGATAAATGA
ATGAGAACGGTTAACTATAGCGAAGCCCGGCAAAATCTGGCCGATGTGCTGGAAAGCGCAGTGACAGGTGTACCTGTGAC
CATTACCCGTCGTGGGCATAAATCTGCAGTCATCATTAGTGCAGAAGAGTTTGAACGCTACCAGGCGGCCAGAATGGATG
ATGAGTTCGCGGCTATCATGGCGGTTCATGGTGATGAGATCAGGGAGCTTGCGGATAAATGA
Structures
Toxin
Loading, please wait
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0X1KZS6 |
Antitoxin
Loading, please wait
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0X1KZS8 |