Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | parDE/ParE-RHH |
Location | 350616..351154 | Replicon | chromosome |
Accession | NZ_CP047304 | ||
Organism | Vibrio cholerae O1 biovar El Tor strain E7946 |
Toxin (Protein)
Gene name | parE | Uniprot ID | Q9KMJ0 |
Locus tag | GTF74_RS15445 | Protein ID | WP_000802136.1 |
Coordinates | 350616..350915 (-) | Length | 100 a.a. |
Antitoxin (Protein)
Gene name | parD | Uniprot ID | P58093 |
Locus tag | GTF74_RS15450 | Protein ID | WP_001107719.1 |
Coordinates | 350912..351154 (-) | Length | 81 a.a. |
Genomic Context
Location: 346551..346733 (183 bp)
Type: Others
Protein ID: WP_000923182.1
Type: Others
Protein ID: WP_000923182.1
Location: 346933..347406 (474 bp)
Type: Others
Protein ID: WP_001161076.1
Type: Others
Protein ID: WP_001161076.1
Location: 347403..347513 (111 bp)
Type: Others
Protein ID: WP_071908312.1
Type: Others
Protein ID: WP_071908312.1
Location: 347555..348181 (627 bp)
Type: Others
Protein ID: WP_000365424.1
Type: Others
Protein ID: WP_000365424.1
Location: 348304..349002 (699 bp)
Type: Others
Protein ID: WP_001890502.1
Type: Others
Protein ID: WP_001890502.1
Location: 349006..349122 (117 bp)
Type: Others
Protein ID: WP_071908339.1
Type: Others
Protein ID: WP_071908339.1
Location: 349700..349879 (180 bp)
Type: Others
Protein ID: WP_001883058.1
Type: Others
Protein ID: WP_001883058.1
Location: 350093..350488 (396 bp)
Type: Others
Protein ID: WP_000870857.1
Type: Others
Protein ID: WP_000870857.1
Location: 351383..351961 (579 bp)
Type: Others
Protein ID: WP_000110120.1
Type: Others
Protein ID: WP_000110120.1
Location: 351965..352075 (111 bp)
Type: Others
Protein ID: WP_071908313.1
Type: Others
Protein ID: WP_071908313.1
Location: 352499..353182 (684 bp)
Type: Others
Protein ID: WP_000877436.1
Type: Others
Protein ID: WP_000877436.1
Location: 353396..353662 (267 bp)
Type: Others
Protein ID: WP_000937852.1
Type: Others
Protein ID: WP_000937852.1
Location: 353817..354416 (600 bp)
Type: Others
Protein ID: WP_000429495.1
Type: Others
Protein ID: WP_000429495.1
Location: 354697..355632 (936 bp)
Type: Others
Protein ID: WP_000051985.1
Type: Others
Protein ID: WP_000051985.1
Location: 355598..355738 (141 bp)
Type: Others
Protein ID: WP_001883049.1
Type: Others
Protein ID: WP_001883049.1
Location: 350616..350915 (300 bp)
Type: Toxin
Protein ID: WP_000802136.1
Type: Toxin
Protein ID: WP_000802136.1
Location: 350912..351154 (243 bp)
Type: Antitoxin
Protein ID: WP_001107719.1
Type: Antitoxin
Protein ID: WP_001107719.1
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
GTF74_RS15405 | 346551..346733 | + | 183 | WP_000923182.1 | DUF645 family protein | - |
GTF74_RS15410 | 346933..347406 | + | 474 | WP_001161076.1 | GrpB family protein | - |
GTF74_RS15415 | 347403..347513 | + | 111 | WP_071908312.1 | DUF3265 domain-containing protein | - |
GTF74_RS15420 | 347555..348181 | + | 627 | WP_000365424.1 | LysE family translocator | - |
GTF74_RS15425 | 348304..349002 | + | 699 | WP_001890502.1 | hypothetical protein | - |
GTF74_RS15430 | 349006..349122 | + | 117 | WP_071908339.1 | DUF3265 domain-containing protein | - |
GTF74_RS15435 | 349700..349879 | + | 180 | WP_001883058.1 | DUF645 family protein | - |
GTF74_RS15440 | 350093..350488 | + | 396 | WP_000870857.1 | DUF3465 domain-containing protein | - |
GTF74_RS15445 | 350616..350915 | - | 300 | WP_000802136.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
GTF74_RS15450 | 350912..351154 | - | 243 | WP_001107719.1 | type II toxin-antitoxin system ParD family antitoxin | Antitoxin |
GTF74_RS15455 | 351383..351961 | + | 579 | WP_000110120.1 | hypothetical protein | - |
GTF74_RS15460 | 351965..352075 | + | 111 | WP_071908313.1 | DUF3265 domain-containing protein | - |
GTF74_RS15465 | 352499..353182 | + | 684 | WP_000877436.1 | hypothetical protein | - |
GTF74_RS15470 | 353396..353662 | + | 267 | WP_000937852.1 | hypothetical protein | - |
GTF74_RS15475 | 353817..354416 | + | 600 | WP_000429495.1 | hypothetical protein | - |
GTF74_RS15480 | 354697..355632 | + | 936 | WP_000051985.1 | restriction endonuclease | - |
GTF74_RS15485 | 355598..355738 | + | 141 | WP_001883049.1 | DUF3265 domain-containing protein | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | catB9 | - | 307032..436751 | 129719 | |
inside | Integron | - | - | 312112..436375 | 124263 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 100 a.a. Molecular weight: 11589.29 Da Isoelectric Point: 9.9232
>T145888 WP_000802136.1 NZ_CP047304:c350915-350616 [Vibrio cholerae O1 biovar El Tor]
MKPFNLTVAAKADLRDIALFTQRRWGKEQRNVYLKQFDDSFWLLAENPDIGKSCDEIREGYRKFPQGSHVIFYQQTGSQQ
IRVIRILHKSMDVNPIFGA
MKPFNLTVAAKADLRDIALFTQRRWGKEQRNVYLKQFDDSFWLLAENPDIGKSCDEIREGYRKFPQGSHVIFYQQTGSQQ
IRVIRILHKSMDVNPIFGA
Download Length: 300 bp
>T145888 NZ_CP062706:2066-2341 [Escherichia coli O157:H7]
ATGGAACTGAAGTGGAGCAGTAAAGCGCTTTCTGATTTGGCGCGGTTATATGATTTTCTGGTGCTAGCCAGTAAACCTGC
TGCCGCCAGAACGGTACAGTCCCTGACACAGGCACCGGTCATTCTGTTAACTCATCCACGTATGGGGGAACAGTTATTTC
AGTTTGAACCCAGGGAGGTCAGACGGATTTTTGCTGGCGAGTACGAAATCCGTTACGAACTTAATGGCCAGACTATTTAT
GTATTGCGCCTGTGGCACACACGAGAAAACAGGTAG
ATGGAACTGAAGTGGAGCAGTAAAGCGCTTTCTGATTTGGCGCGGTTATATGATTTTCTGGTGCTAGCCAGTAAACCTGC
TGCCGCCAGAACGGTACAGTCCCTGACACAGGCACCGGTCATTCTGTTAACTCATCCACGTATGGGGGAACAGTTATTTC
AGTTTGAACCCAGGGAGGTCAGACGGATTTTTGCTGGCGAGTACGAAATCCGTTACGAACTTAATGGCCAGACTATTTAT
GTATTGCGCCTGTGGCACACACGAGAAAACAGGTAG
Antitoxin
Download Length: 81 a.a. Molecular weight: 8964.84 Da Isoelectric Point: 4.1677
>AT145888 WP_001107719.1 NZ_CP047304:c351154-350912 [Vibrio cholerae O1 biovar El Tor]
MAKNTSITLGEHFDGFITSQIQSGRYGSASEVIRSALRLLENQETKLQSLRQLLIEGEQSGDADYDLDSFINELDSENIR
MAKNTSITLGEHFDGFITSQIQSGRYGSASEVIRSALRLLENQETKLQSLRQLLIEGEQSGDADYDLDSFINELDSENIR
Download Length: 243 bp
>AT145888 NZ_CP062706:1782-2066 [Escherichia coli O157:H7]
ATGCAAATGAAAAACAATACCGCACAAGCAACAAAAGTCATTACCGCGCATGTGCCATTACCTATGGCTGATAAAGTCGA
CCAGATGGCCGCCAGACTGGAACGCTCCCGGGGTTGGGTTATCAAACAGGCGCTTTCTGCATGGCTTGCCCAGGAGGAGG
AGCGTAATCGCCTGACGCTGGAAGCCCTGGACGATGTGACATCCGGACAGGTTATTGACCATCAGGCTGTACAGGCCTGG
GCGGACAGCCTCAGTACTGACAATCCGTTACCGGTGCCACGCTGA
ATGCAAATGAAAAACAATACCGCACAAGCAACAAAAGTCATTACCGCGCATGTGCCATTACCTATGGCTGATAAAGTCGA
CCAGATGGCCGCCAGACTGGAACGCTCCCGGGGTTGGGTTATCAAACAGGCGCTTTCTGCATGGCTTGCCCAGGAGGAGG
AGCGTAATCGCCTGACGCTGGAAGCCCTGGACGATGTGACATCCGGACAGGTTATTGACCATCAGGCTGTACAGGCCTGG
GCGGACAGCCTCAGTACTGACAATCCGTTACCGGTGCCACGCTGA
Structures
Toxin
Loading, please wait
Source | ID | Structure |
---|---|---|
PDB | 7R5A |
Antitoxin
Loading, please wait
Source | ID | Structure |
---|---|---|
PDB | 7R5A | |
PDB | 7B22 | |
AlphaFold DB | A0A151JFU4 |