Detailed information of TA system TA145879

Bioinformatically predicted

Overview

TA module

• Type: II
• Classification (family/domain): dhiT-phd/-
• Location: 406280..406684
• Replicon: chromosome
• Accession: NZ_CP047302
• Organism: Vibrio cholerae O1 biovar El Tor strain DRC-193A

Toxin (Protein)

• Gene name: dhiT
• Uniprot ID: A0A086SLD6
• Locus tag: GTF75_RS16085
• Protein ID: WP_001114075.1
• Coordinates: 406415..406684 (+)
• Length: 90 a.a.

Antitoxin (Protein)

• Gene name: phd
• Uniprot ID: -
• Locus tag: GTF75_RS16080
• Protein ID: WP_099607150.1
• Coordinates: 406280..406384 (+)
• Length: 35 a.a.

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
GTF75_RS16045	401781..402698	+	918	WP_000186333.1	alpha/beta hydrolase	-
GTF75_RS16050	402855..403244	+	390	WP_001081302.1	hypothetical protein	-
GTF75_RS16055	403380..403589	+	210	Protein_430	GNAT family N-acetyltransferase	-
GTF75_RS16060	403708..404145	+	438	WP_000503169.1	IS200/IS605-like element IS1004 family transposase	-
GTF75_RS16065	404209..404427	+	219	WP_071908318.1	GNAT family N-acetyltransferase	-
GTF75_RS16070	404602..405474	+	873	WP_000254716.1	DUF3800 domain-containing protein	-
GTF75_RS16075	405624..406223	+	600	WP_001891245.1	glutathione S-transferase N-terminal domain-containing protein	-
GTF75_RS16080	406280..406384	+	105	WP_099607150.1	acetyltransferase	Antitoxin
GTF75_RS16085	406415..406684	+	270	WP_001114075.1	DUF4160 domain-containing protein	Toxin
GTF75_RS16090	406678..407199	+	522	WP_000921691.1	DUF2442 domain-containing protein	-
GTF75_RS16095	407498..407623	+	126	WP_001905700.1	DUF645 family protein	-
GTF75_RS16100	407874..408269	+	396	WP_001000867.1	hypothetical protein	-
GTF75_RS16105	408408..408686	-	279	WP_000578476.1	type II toxin-antitoxin system mRNA interferase toxin, RelE/StbE family	-
GTF75_RS16110	408683..408967	-	285	WP_000381183.1	type II toxin-antitoxin system RelB/DinJ family antitoxin	-
GTF75_RS16115	409161..409676	+	516	WP_000343779.1	GNAT family N-acetyltransferase	-
GTF75_RS16120	409733..409828	+	96	WP_099607151.1	acetyltransferase	-
GTF75_RS16125	409860..410273	+	414	WP_000049420.1	VOC family protein	-
GTF75_RS16130	410280..410412	-	133	Protein_445	hypothetical protein	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)
	-	inside	Genomic island	catB9	-	305935..411136	105201
	Similar MGE(s) Similar MGE(s) is defined as other TA-related MGE(s) with Mash distance < 0.01 to this MGE. Detail Genome accession Organism MGE type Related TA Coordinates Mash distance View NC_002506 Vibrio cholerae O1 biovar El Tor str. N16961 Integron TA000164, TA000169, TA000166, TA000167, TA000179, TA000170, TA000171, TA000172, TA000173, TA000174, TA000175, TA000176, TA000177, TA000178, TA000168, TA000165, TA010030, TA010035 309750..435387 0.004	inside	Integron	-	-	311015..410760	99745
	Similar MGE(s) Similar MGE(s) is defined as other TA-related MGE(s) with Mash distance < 0.01 to this MGE. Detail Genome accession Organism MGE type Related TA Coordinates Mash distance View NC_002506 Vibrio cholerae O1 biovar El Tor str. N16961 IS/Tn TA000179, TA000177, TA000178, TA010035 428335..428772 0	flank	IS/Tn	-	-	403708..404145	437

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Protein of unknown function DUF4160 (9-74)

Antitoxin

No domain identified.

Sequences

Toxin

Protein

• Length: 90 a.a.
• Molecular weight: 10310.94 Da
• Isoelectric Point: 6.6303

>T145879 WP_001114075.1 NZ_CP047302:406415-406684 [Vibrio cholerae O1 biovar El Tor]
MPEIDALLGLSFCLYFFDNKQHKLPHIHVKYGSYELIIAIETGECLEGYLPNKQRKRAENHILEHREQLMVMWNKAVNGE
NPGKLGDLC

Nucleotide

• Length: 270 bp

>T145879 NZ_CP062705:3594441-3594728 [Escherichia coli O157:H7]
ATGTTACCCATTTTATGGCTACCGTCTGCTCGCGATGATTTGCGCCAGATCATAACTTACATCGCCAAGGAGAACCCACC
GGCAGCACGTAGACTAAAAATACGCATTGAAACATCGGTATTACCTCTATCTGAGCATCCGTACTTATATCCACCAAGCG
AACGGGTTTCTGGATTGAGAGAGATCGTGACCCACCCTAACTACATAATCCTGTACAGAGTAGCTGCTTCAAGCATTGAG
ATTGTAAGCGTGACACATTCTCGGCGACAATTTCCCTTCTCTATCTGA

Antitoxin

Protein

• Length: 35 a.a.
• Molecular weight: 3991.79 Da
• Isoelectric Point: 9.2853

>AT145879 WP_099607150.1 NZ_CP047302:406280-406384 [Vibrio cholerae O1 biovar El Tor]
VVSVVVFEFSSMRCQPLRRALYAYRNCLLKDTLL

Nucleotide

• Length: 105 bp

>AT145879 NZ_CP062705:3594250-3594441 [Escherichia coli O157:H7]
ATGGGTACAGCCCTTTCTCCGATAGTTTCAGAATTCGAAACTACCGAACAAGAAAACAGTTACAACGAATGGTTGCGCAC
TAAAGTAACGTCAAGCCTTGCAGACACTCGCCCCGCAATTCCACATGACGAGGTAATGGCTGAAATGGAAAATCTTATTG
CTCAAATTGCTGTAACTAACAAGAGCGAGTAA

Structures

Toxin

• AlphaFold DB: A0A086SLD6