Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | dhiT-phd/- |
Location | 491977..492381 | Replicon | chromosome |
Accession | NZ_CP013318 | ||
Organism | Vibrio cholerae strain NCTC5395 |
Toxin (Protein)
Gene name | dhiT | Uniprot ID | A0A086SLD6 |
Locus tag | ASZ85_RS17185 | Protein ID | WP_001114075.1 |
Coordinates | 492112..492381 (+) | Length | 90 a.a. |
Antitoxin (Protein)
Gene name | phd | Uniprot ID | - |
Locus tag | ASZ85_RS21230 | Protein ID | WP_099607150.1 |
Coordinates | 491977..492081 (+) | Length | 35 a.a. |
Genomic Context
Location: 487478..488395 (918 bp)
Type: Others
Protein ID: WP_000186333.1
Type: Others
Protein ID: WP_000186333.1
Location: 488552..488941 (390 bp)
Type: Others
Protein ID: WP_001081302.1
Type: Others
Protein ID: WP_001081302.1
Location: 489077..489286 (210 bp)
Type: Others
Protein ID: Protein_549
Type: Others
Protein ID: Protein_549
Location: 489405..489842 (438 bp)
Type: Others
Protein ID: WP_000503169.1
Type: Others
Protein ID: WP_000503169.1
Location: 489906..490124 (219 bp)
Type: Others
Protein ID: WP_071908318.1
Type: Others
Protein ID: WP_071908318.1
Location: 490299..491171 (873 bp)
Type: Others
Protein ID: WP_000254716.1
Type: Others
Protein ID: WP_000254716.1
Location: 491321..491920 (600 bp)
Type: Others
Protein ID: WP_001891245.1
Type: Others
Protein ID: WP_001891245.1
Location: 491977..492081 (105 bp)
Type: Antitoxin
Protein ID: WP_099607150.1
Type: Antitoxin
Protein ID: WP_099607150.1
Location: 492112..492381 (270 bp)
Type: Toxin
Protein ID: WP_001114075.1
Type: Toxin
Protein ID: WP_001114075.1
Location: 492375..492896 (522 bp)
Type: Others
Protein ID: WP_000921691.1
Type: Others
Protein ID: WP_000921691.1
Location: 493195..493320 (126 bp)
Type: Others
Protein ID: WP_001905700.1
Type: Others
Protein ID: WP_001905700.1
Location: 493571..493966 (396 bp)
Type: Others
Protein ID: WP_001000867.1
Type: Others
Protein ID: WP_001000867.1
Location: 494858..495373 (516 bp)
Type: Others
Protein ID: WP_000343779.1
Type: Others
Protein ID: WP_000343779.1
Location: 495557..495970 (414 bp)
Type: Others
Protein ID: WP_000049420.1
Type: Others
Protein ID: WP_000049420.1
Location: 494105..494383 (279 bp)
Type: Others
Protein ID: WP_000578476.1
Type: Others
Protein ID: WP_000578476.1
Location: 494380..494664 (285 bp)
Type: Others
Protein ID: WP_000381183.1
Type: Others
Protein ID: WP_000381183.1
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
ASZ85_RS17140 | 487478..488395 | + | 918 | WP_000186333.1 | alpha/beta hydrolase | - |
ASZ85_RS17150 | 488552..488941 | + | 390 | WP_001081302.1 | hypothetical protein | - |
ASZ85_RS17155 | 489077..489286 | + | 210 | Protein_549 | GNAT family N-acetyltransferase | - |
ASZ85_RS17160 | 489405..489842 | + | 438 | WP_000503169.1 | IS200/IS605-like element IS1004 family transposase | - |
ASZ85_RS17165 | 489906..490124 | + | 219 | WP_071908318.1 | GNAT family N-acetyltransferase | - |
ASZ85_RS17175 | 490299..491171 | + | 873 | WP_000254716.1 | DUF3800 domain-containing protein | - |
ASZ85_RS17180 | 491321..491920 | + | 600 | WP_001891245.1 | glutathione S-transferase N-terminal domain-containing protein | - |
ASZ85_RS21230 | 491977..492081 | + | 105 | WP_099607150.1 | acetyltransferase | Antitoxin |
ASZ85_RS17185 | 492112..492381 | + | 270 | WP_001114075.1 | DUF4160 domain-containing protein | Toxin |
ASZ85_RS17190 | 492375..492896 | + | 522 | WP_000921691.1 | DUF2442 domain-containing protein | - |
ASZ85_RS21235 | 493195..493320 | + | 126 | WP_001905700.1 | DUF645 family protein | - |
ASZ85_RS17205 | 493571..493966 | + | 396 | WP_001000867.1 | hypothetical protein | - |
ASZ85_RS17210 | 494105..494383 | - | 279 | WP_000578476.1 | type II toxin-antitoxin system mRNA interferase toxin, RelE/StbE family | - |
ASZ85_RS17215 | 494380..494664 | - | 285 | WP_000381183.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | - |
ASZ85_RS17220 | 494858..495373 | + | 516 | WP_000343779.1 | GNAT family N-acetyltransferase | - |
ASZ85_RS17225 | 495557..495970 | + | 414 | WP_000049420.1 | VOC family protein | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | - | 338285..496833 | 158548 | |
inside | Integron | - | - | 343365..496457 | 153092 | ||
flank | IS/Tn | - | - | 489405..489842 | 437 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 90 a.a. Molecular weight: 10310.94 Da Isoelectric Point: 6.6303
>T58409 WP_001114075.1 NZ_CP013318:492112-492381 [Vibrio cholerae]
MPEIDALLGLSFCLYFFDNKQHKLPHIHVKYGSYELIIAIETGECLEGYLPNKQRKRAENHILEHREQLMVMWNKAVNGE
NPGKLGDLC
MPEIDALLGLSFCLYFFDNKQHKLPHIHVKYGSYELIIAIETGECLEGYLPNKQRKRAENHILEHREQLMVMWNKAVNGE
NPGKLGDLC
Download Length: 270 bp
>T58409 NZ_CP013318:492112-492381 [Vibrio cholerae]
ATGCCAGAGATTGATGCCCTATTAGGTCTTTCATTTTGCTTGTACTTCTTTGATAACAAGCAGCATAAATTACCTCATAT
TCACGTTAAGTACGGTAGTTACGAGCTAATTATTGCTATTGAAACAGGTGAGTGTTTAGAGGGTTACTTACCCAATAAGC
AACGAAAACGTGCTGAAAACCATATTCTTGAACATCGAGAGCAATTGATGGTGATGTGGAATAAAGCGGTGAATGGTGAA
AATCCAGGTAAGTTAGGTGATTTATGTTGA
ATGCCAGAGATTGATGCCCTATTAGGTCTTTCATTTTGCTTGTACTTCTTTGATAACAAGCAGCATAAATTACCTCATAT
TCACGTTAAGTACGGTAGTTACGAGCTAATTATTGCTATTGAAACAGGTGAGTGTTTAGAGGGTTACTTACCCAATAAGC
AACGAAAACGTGCTGAAAACCATATTCTTGAACATCGAGAGCAATTGATGGTGATGTGGAATAAAGCGGTGAATGGTGAA
AATCCAGGTAAGTTAGGTGATTTATGTTGA
Antitoxin
Download Length: 35 a.a. Molecular weight: 3991.79 Da Isoelectric Point: 9.2853
>AT58409 WP_099607150.1 NZ_CP013318:491977-492081 [Vibrio cholerae]
VVSVVVFEFSSMRCQPLRRALYAYRNCLLKDTLL
VVSVVVFEFSSMRCQPLRRALYAYRNCLLKDTLL
Download Length: 105 bp
>AT58409 NZ_CP013318:491977-492081 [Vibrio cholerae]
GTGGTTTCGGTTGTTGTGTTTGAGTTTAGTAGTATGCGCTGCCAGCCCCTTAGGCGGGCGTTATATGCTTATAGGAATTG
TCTCCTAAAGGATACGCTGCTATAG
GTGGTTTCGGTTGTTGTGTTTGAGTTTAGTAGTATGCGCTGCCAGCCCCTTAGGCGGGCGTTATATGCTTATAGGAATTG
TCTCCTAAAGGATACGCTGCTATAG
Structures
Toxin
Loading, please wait
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A086SLD6 |
Antitoxin
Loading, please wait
Source | ID | Structure |
---|---|---|
No matching records found |