Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | parDE/ParE-RHH |
Location | 332880..333418 | Replicon | chromosome |
Accession | NZ_CP013302 | ||
Organism | Vibrio cholerae strain C5 |
Toxin (Protein)
Gene name | parE | Uniprot ID | Q9KMJ0 |
Locus tag | ASZ80_RS15790 | Protein ID | WP_000802136.1 |
Coordinates | 332880..333179 (-) | Length | 100 a.a. |
Antitoxin (Protein)
Gene name | parD | Uniprot ID | P58093 |
Locus tag | ASZ80_RS15795 | Protein ID | WP_001107719.1 |
Coordinates | 333176..333418 (-) | Length | 81 a.a. |
Genomic Context
Location: 328085..328267 (183 bp)
Type: Others
Protein ID: WP_000923340.1
Type: Others
Protein ID: WP_000923340.1
Location: 328482..329021 (540 bp)
Type: Others
Protein ID: WP_000099372.1
Type: Others
Protein ID: WP_000099372.1
Location: 329144..329659 (516 bp)
Type: Others
Protein ID: WP_000090011.1
Type: Others
Protein ID: WP_000090011.1
Location: 329794..330330 (537 bp)
Type: Others
Protein ID: WP_000644491.1
Type: Others
Protein ID: WP_000644491.1
Location: 330449..330610 (162 bp)
Type: Others
Protein ID: WP_000481782.1
Type: Others
Protein ID: WP_000481782.1
Location: 330799..330909 (111 bp)
Type: Others
Protein ID: WP_071908335.1
Type: Others
Protein ID: WP_071908335.1
Location: 331122..331274 (153 bp)
Type: Others
Protein ID: WP_001884520.1
Type: Others
Protein ID: WP_001884520.1
Location: 331558..332001 (444 bp)
Type: Others
Protein ID: WP_000803902.1
Type: Others
Protein ID: WP_000803902.1
Location: 332005..332115 (111 bp)
Type: Others
Protein ID: WP_071908336.1
Type: Others
Protein ID: WP_071908336.1
Location: 333837..333914 (78 bp)
Type: Others
Protein ID: WP_071908337.1
Type: Others
Protein ID: WP_071908337.1
Location: 333918..333944 (27 bp)
Type: Others
Protein ID: Protein_299
Type: Others
Protein ID: Protein_299
Location: 334530..334673 (144 bp)
Type: Others
Protein ID: WP_001900215.1
Type: Others
Protein ID: WP_001900215.1
Location: 334767..334946 (180 bp)
Type: Others
Protein ID: Protein_301
Type: Others
Protein ID: Protein_301
Location: 335164..335592 (429 bp)
Type: Others
Protein ID: WP_000620002.1
Type: Others
Protein ID: WP_000620002.1
Location: 336180..336662 (483 bp)
Type: Others
Protein ID: WP_000422940.1
Type: Others
Protein ID: WP_000422940.1
Location: 337470..337739 (270 bp)
Type: Others
Protein ID: WP_001114075.1
Type: Others
Protein ID: WP_001114075.1
Location: 337733..338254 (522 bp)
Type: Others
Protein ID: WP_000921692.1
Type: Others
Protein ID: WP_000921692.1
Location: 332145..332423 (279 bp)
Type: Others
Protein ID: WP_000578476.1
Type: Others
Protein ID: WP_000578476.1
Location: 332420..332704 (285 bp)
Type: Others
Protein ID: WP_000381183.1
Type: Others
Protein ID: WP_000381183.1
Location: 332880..333179 (300 bp)
Type: Toxin
Protein ID: WP_000802136.1
Type: Toxin
Protein ID: WP_000802136.1
Location: 333176..333418 (243 bp)
Type: Antitoxin
Protein ID: WP_001107719.1
Type: Antitoxin
Protein ID: WP_001107719.1
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
ASZ80_RS15730 | 328085..328267 | + | 183 | WP_000923340.1 | DUF645 family protein | - |
ASZ80_RS15735 | 328482..329021 | + | 540 | WP_000099372.1 | hypothetical protein | - |
ASZ80_RS15740 | 329144..329659 | + | 516 | WP_000090011.1 | hypothetical protein | - |
ASZ80_RS15745 | 329794..330330 | + | 537 | WP_000644491.1 | nucleotidyltransferase family protein | - |
ASZ80_RS20940 | 330449..330610 | + | 162 | WP_000481782.1 | hypothetical protein | - |
ASZ80_RS15750 | 330799..330909 | + | 111 | WP_071908335.1 | DUF3265 domain-containing protein | - |
ASZ80_RS15760 | 331122..331274 | + | 153 | WP_001884520.1 | DUF645 family protein | - |
ASZ80_RS15765 | 331558..332001 | + | 444 | WP_000803902.1 | hypothetical protein | - |
ASZ80_RS15770 | 332005..332115 | + | 111 | WP_071908336.1 | DUF3265 domain-containing protein | - |
ASZ80_RS15775 | 332145..332423 | - | 279 | WP_000578476.1 | type II toxin-antitoxin system mRNA interferase toxin, RelE/StbE family | - |
ASZ80_RS15780 | 332420..332704 | - | 285 | WP_000381183.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | - |
ASZ80_RS15790 | 332880..333179 | - | 300 | WP_000802136.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
ASZ80_RS15795 | 333176..333418 | - | 243 | WP_001107719.1 | type II toxin-antitoxin system ParD family antitoxin | Antitoxin |
ASZ80_RS15805 | 333837..333914 | + | 78 | WP_071908337.1 | DUF645 family protein | - |
ASZ80_RS20860 | 333918..333944 | + | 27 | Protein_299 | hypothetical protein | - |
ASZ80_RS20945 | 334530..334673 | + | 144 | WP_001900215.1 | hypothetical protein | - |
ASZ80_RS20420 | 334767..334946 | + | 180 | Protein_301 | DUF645 family protein | - |
ASZ80_RS15830 | 335164..335592 | + | 429 | WP_000620002.1 | N-acetyltransferase | - |
ASZ80_RS15840 | 336180..336662 | + | 483 | WP_000422940.1 | GNAT family N-acetyltransferase | - |
ASZ80_RS15850 | 337470..337739 | + | 270 | WP_001114075.1 | DUF4160 domain-containing protein | - |
ASZ80_RS15855 | 337733..338254 | + | 522 | WP_000921692.1 | DUF2442 domain-containing protein | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | catB9 | - | 304694..469286 | 164592 | |
inside | Integron | - | - | 309774..468910 | 159136 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 100 a.a. Molecular weight: 11589.29 Da Isoelectric Point: 9.9232
>T58215 WP_000802136.1 NZ_CP013302:c333179-332880 [Vibrio cholerae]
MKPFNLTVAAKADLRDIALFTQRRWGKEQRNVYLKQFDDSFWLLAENPDIGKSCDEIREGYRKFPQGSHVIFYQQTGSQQ
IRVIRILHKSMDVNPIFGA
MKPFNLTVAAKADLRDIALFTQRRWGKEQRNVYLKQFDDSFWLLAENPDIGKSCDEIREGYRKFPQGSHVIFYQQTGSQQ
IRVIRILHKSMDVNPIFGA
Download Length: 300 bp
>T58215 NZ_CP013302:c333179-332880 [Vibrio cholerae]
ATGAAACCATTTAATCTTACCGTCGCCGCCAAAGCCGATTTACGTGATATTGCTTTATTCACTCAACGACGCTGGGGAAA
AGAGCAGCGAAATGTTTATTTAAAGCAATTCGATGATTCCTTTTGGCTTTTAGCGGAAAATCCCGACATTGGTAAATCAT
GCGATGAAATCCGAGAGGGATACAGAAAATTTCCCCAAGGGAGTCACGTCATCTTTTATCAGCAAACCGGCAGCCAACAA
ATCCGGGTGATCCGAATTCTTCATAAGAGCATGGATGTGAACCCAATATTCGGCGCATAA
ATGAAACCATTTAATCTTACCGTCGCCGCCAAAGCCGATTTACGTGATATTGCTTTATTCACTCAACGACGCTGGGGAAA
AGAGCAGCGAAATGTTTATTTAAAGCAATTCGATGATTCCTTTTGGCTTTTAGCGGAAAATCCCGACATTGGTAAATCAT
GCGATGAAATCCGAGAGGGATACAGAAAATTTCCCCAAGGGAGTCACGTCATCTTTTATCAGCAAACCGGCAGCCAACAA
ATCCGGGTGATCCGAATTCTTCATAAGAGCATGGATGTGAACCCAATATTCGGCGCATAA
Antitoxin
Download Length: 81 a.a. Molecular weight: 8964.84 Da Isoelectric Point: 4.1677
>AT58215 WP_001107719.1 NZ_CP013302:c333418-333176 [Vibrio cholerae]
MAKNTSITLGEHFDGFITSQIQSGRYGSASEVIRSALRLLENQETKLQSLRQLLIEGEQSGDADYDLDSFINELDSENIR
MAKNTSITLGEHFDGFITSQIQSGRYGSASEVIRSALRLLENQETKLQSLRQLLIEGEQSGDADYDLDSFINELDSENIR
Download Length: 243 bp
>AT58215 NZ_CP013302:c333418-333176 [Vibrio cholerae]
ATGGCTAAAAATACAAGTATCACTCTTGGTGAACACTTCGATGGCTTTATTACAAGCCAAATACAAAGTGGGCGTTACGG
CTCAGCAAGTGAAGTCATTCGCTCTGCGCTACGTCTACTCGAAAACCAAGAAACCAAACTACAGTCACTCCGTCAACTAC
TTATTGAAGGAGAGCAAAGTGGTGACGCTGATTATGACCTTGATAGCTTCATCAATGAACTCGATAGTGAAAACATTCGA
TGA
ATGGCTAAAAATACAAGTATCACTCTTGGTGAACACTTCGATGGCTTTATTACAAGCCAAATACAAAGTGGGCGTTACGG
CTCAGCAAGTGAAGTCATTCGCTCTGCGCTACGTCTACTCGAAAACCAAGAAACCAAACTACAGTCACTCCGTCAACTAC
TTATTGAAGGAGAGCAAAGTGGTGACGCTGATTATGACCTTGATAGCTTCATCAATGAACTCGATAGTGAAAACATTCGA
TGA
Structures
Toxin
Loading, please wait
Source | ID | Structure |
---|---|---|
PDB | 7R5A |
Antitoxin
Loading, please wait
Source | ID | Structure |
---|---|---|
PDB | 7R5A | |
PDB | 7B22 | |
AlphaFold DB | A0A151JFU4 |