Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | dhiT-phd/- |
Location | 433217..433621 | Replicon | chromosome |
Accession | NZ_CP028828 | ||
Organism | Vibrio cholerae strain N16961 |
Toxin (Protein)
Gene name | dhiT | Uniprot ID | A0A086SLD6 |
Locus tag | N16961_RS16680 | Protein ID | WP_001114075.1 |
Coordinates | 433352..433621 (+) | Length | 90 a.a. |
Antitoxin (Protein)
Gene name | phd | Uniprot ID | - |
Locus tag | N16961_RS16675 | Protein ID | WP_099607150.1 |
Coordinates | 433217..433321 (+) | Length | 35 a.a. |
Genomic Context
Location: 428718..429635 (918 bp)
Type: Others
Protein ID: WP_000186333.1
Type: Others
Protein ID: WP_000186333.1
Location: 429792..430181 (390 bp)
Type: Others
Protein ID: WP_001081302.1
Type: Others
Protein ID: WP_001081302.1
Location: 430317..430526 (210 bp)
Type: Others
Protein ID: Protein_468
Type: Others
Protein ID: Protein_468
Location: 430645..431082 (438 bp)
Type: Others
Protein ID: WP_000503169.1
Type: Others
Protein ID: WP_000503169.1
Location: 431146..431364 (219 bp)
Type: Others
Protein ID: WP_071908318.1
Type: Others
Protein ID: WP_071908318.1
Location: 431539..432411 (873 bp)
Type: Others
Protein ID: WP_000254716.1
Type: Others
Protein ID: WP_000254716.1
Location: 432561..433160 (600 bp)
Type: Others
Protein ID: WP_001891245.1
Type: Others
Protein ID: WP_001891245.1
Location: 433217..433321 (105 bp)
Type: Antitoxin
Protein ID: WP_099607150.1
Type: Antitoxin
Protein ID: WP_099607150.1
Location: 433352..433621 (270 bp)
Type: Toxin
Protein ID: WP_001114075.1
Type: Toxin
Protein ID: WP_001114075.1
Location: 433615..434136 (522 bp)
Type: Others
Protein ID: WP_000921691.1
Type: Others
Protein ID: WP_000921691.1
Location: 434435..434560 (126 bp)
Type: Others
Protein ID: WP_001905700.1
Type: Others
Protein ID: WP_001905700.1
Location: 434811..435206 (396 bp)
Type: Others
Protein ID: WP_001000867.1
Type: Others
Protein ID: WP_001000867.1
Location: 436098..436613 (516 bp)
Type: Others
Protein ID: WP_000343779.1
Type: Others
Protein ID: WP_000343779.1
Location: 436797..437210 (414 bp)
Type: Others
Protein ID: WP_000049420.1
Type: Others
Protein ID: WP_000049420.1
Location: 435345..435623 (279 bp)
Type: Others
Protein ID: WP_000578476.1
Type: Others
Protein ID: WP_000578476.1
Location: 435620..435904 (285 bp)
Type: Others
Protein ID: WP_000381183.1
Type: Others
Protein ID: WP_000381183.1
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N16961_RS16640 | 428718..429635 | + | 918 | WP_000186333.1 | alpha/beta hydrolase | - |
N16961_RS16645 | 429792..430181 | + | 390 | WP_001081302.1 | hypothetical protein | - |
N16961_RS16650 | 430317..430526 | + | 210 | Protein_468 | GNAT family N-acetyltransferase | - |
N16961_RS16655 | 430645..431082 | + | 438 | WP_000503169.1 | IS200/IS605-like element IS1004 family transposase | - |
N16961_RS16660 | 431146..431364 | + | 219 | WP_071908318.1 | GNAT family N-acetyltransferase | - |
N16961_RS16665 | 431539..432411 | + | 873 | WP_000254716.1 | DUF3800 domain-containing protein | - |
N16961_RS16670 | 432561..433160 | + | 600 | WP_001891245.1 | glutathione S-transferase N-terminal domain-containing protein | - |
N16961_RS16675 | 433217..433321 | + | 105 | WP_099607150.1 | acetyltransferase | Antitoxin |
N16961_RS16680 | 433352..433621 | + | 270 | WP_001114075.1 | DUF4160 domain-containing protein | Toxin |
N16961_RS16685 | 433615..434136 | + | 522 | WP_000921691.1 | DUF2442 domain-containing protein | - |
N16961_RS16690 | 434435..434560 | + | 126 | WP_001905700.1 | DUF645 family protein | - |
N16961_RS16700 | 434811..435206 | + | 396 | WP_001000867.1 | hypothetical protein | - |
N16961_RS16705 | 435345..435623 | - | 279 | WP_000578476.1 | type II toxin-antitoxin system mRNA interferase toxin, RelE/StbE family | - |
N16961_RS16710 | 435620..435904 | - | 285 | WP_000381183.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | - |
N16961_RS16715 | 436098..436613 | + | 516 | WP_000343779.1 | GNAT family N-acetyltransferase | - |
N16961_RS16725 | 436797..437210 | + | 414 | WP_000049420.1 | VOC family protein | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | catB9 | - | 306977..438073 | 131096 | |
inside | Integron | - | - | 312057..437697 | 125640 | ||
flank | IS/Tn | - | - | 430645..431082 | 437 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 90 a.a. Molecular weight: 10310.94 Da Isoelectric Point: 6.6303
>T104262 WP_001114075.1 NZ_CP028828:433352-433621 [Vibrio cholerae]
MPEIDALLGLSFCLYFFDNKQHKLPHIHVKYGSYELIIAIETGECLEGYLPNKQRKRAENHILEHREQLMVMWNKAVNGE
NPGKLGDLC
MPEIDALLGLSFCLYFFDNKQHKLPHIHVKYGSYELIIAIETGECLEGYLPNKQRKRAENHILEHREQLMVMWNKAVNGE
NPGKLGDLC
Download Length: 270 bp
>T104262 NZ_CP028828:433352-433621 [Vibrio cholerae]
ATGCCAGAGATTGATGCCCTATTAGGTCTTTCATTTTGCTTGTACTTCTTTGATAACAAGCAGCATAAATTACCTCATAT
TCACGTTAAGTACGGTAGTTACGAGCTAATTATTGCTATTGAAACAGGTGAGTGTTTAGAGGGTTACTTACCCAATAAGC
AACGAAAACGTGCTGAAAACCATATTCTTGAACATCGAGAGCAATTGATGGTGATGTGGAATAAAGCGGTGAATGGTGAA
AATCCAGGTAAGTTAGGTGATTTATGTTGA
ATGCCAGAGATTGATGCCCTATTAGGTCTTTCATTTTGCTTGTACTTCTTTGATAACAAGCAGCATAAATTACCTCATAT
TCACGTTAAGTACGGTAGTTACGAGCTAATTATTGCTATTGAAACAGGTGAGTGTTTAGAGGGTTACTTACCCAATAAGC
AACGAAAACGTGCTGAAAACCATATTCTTGAACATCGAGAGCAATTGATGGTGATGTGGAATAAAGCGGTGAATGGTGAA
AATCCAGGTAAGTTAGGTGATTTATGTTGA
Antitoxin
Download Length: 35 a.a. Molecular weight: 3991.79 Da Isoelectric Point: 9.2853
>AT104262 WP_099607150.1 NZ_CP028828:433217-433321 [Vibrio cholerae]
VVSVVVFEFSSMRCQPLRRALYAYRNCLLKDTLL
VVSVVVFEFSSMRCQPLRRALYAYRNCLLKDTLL
Download Length: 105 bp
>AT104262 NZ_CP028828:433217-433321 [Vibrio cholerae]
GTGGTTTCGGTTGTTGTGTTTGAGTTTAGTAGTATGCGCTGCCAGCCCCTTAGGCGGGCGTTATATGCTTATAGGAATTG
TCTCCTAAAGGATACGCTGCTATAG
GTGGTTTCGGTTGTTGTGTTTGAGTTTAGTAGTATGCGCTGCCAGCCCCTTAGGCGGGCGTTATATGCTTATAGGAATTG
TCTCCTAAAGGATACGCTGCTATAG
Structures
Toxin
Loading, please wait
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A086SLD6 |
Antitoxin
Loading, please wait
Source | ID | Structure |
---|---|---|
No matching records found |