Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) higBA (relBE)/HigB-HigA
Location 414600..415215 Replicon chromosome
Accession NZ_OW443148
Organism Vibrio cholerae strain CNRVC190243 isolate YE-NCPHL-19014-PI

Toxin (Protein)


Gene name higB Uniprot ID Q9KMG5
Locus tag OC617_RS15975 Protein ID WP_001162670.1
Coordinates 414600..414887 (+) Length 96 a.a.

Antitoxin (Protein)


Gene name higA Uniprot ID -
Locus tag OC617_RS15980 Protein ID WP_001232701.1
Coordinates 414898..415215 (+) Length 106 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OC617_RS15915 409943..410118 + 176 Protein_405 acetyltransferase -
OC617_RS15920 410179..410331 + 153 Protein_406 DUF645 family protein -
OC617_RS15925 (CNRVC190243H_03139) 410525..410842 - 318 WP_001180243.1 type II toxin-antitoxin system RelE/ParE family toxin -
OC617_RS15930 (CNRVC190243H_03140) 410861..411103 - 243 WP_000557292.1 type II toxin-antitoxin system Phd/YefM family antitoxin -
OC617_RS15935 (CNRVC190243H_03141) 411345..411854 + 510 WP_000405987.1 GNAT family N-acetyltransferase -
OC617_RS15940 (CNRVC190243H_03142) 411911..412564 + 654 WP_000226874.1 hypothetical protein -
OC617_RS15945 412653..412862 + 210 WP_001900246.1 DUF3709 domain-containing protein -
OC617_RS15950 412874..413092 + 219 WP_001917086.1 DUF3709 domain-containing protein -
OC617_RS15955 413281..413474 + 194 Protein_413 hypothetical protein -
OC617_RS15960 413495..413728 + 234 WP_032482776.1 DUF3709 domain-containing protein -
OC617_RS15965 414153..414333 + 181 Protein_415 DUF645 family protein -
OC617_RS15970 414446..414559 + 114 WP_001894955.1 hypothetical protein -
OC617_RS15975 (CNRVC190243H_03143) 414600..414887 + 288 WP_001162670.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
OC617_RS15980 (CNRVC190243H_03144) 414898..415215 + 318 WP_001232701.1 HigA family addiction module antitoxin Antitoxin
OC617_RS15985 415212..415322 + 111 WP_134814058.1 DUF3265 domain-containing protein -
OC617_RS15990 415361..415471 + 111 Protein_420 acetyltransferase -
OC617_RS15995 415499..415624 + 126 WP_001944767.1 DUF645 family protein -
OC617_RS16000 415587..415703 + 117 WP_001889170.1 hypothetical protein -
OC617_RS16005 (CNRVC190243H_03145) 415891..416895 + 1005 WP_000964925.1 LD-carboxypeptidase -
OC617_RS16010 (CNRVC190243H_03146) 417048..417494 + 447 WP_000128977.1 hypothetical protein -
OC617_RS16015 (CNRVC190243H_03147) 417614..418543 + 930 WP_000335802.1 hypothetical protein -
OC617_RS16020 418540..418650 + 111 WP_071917832.1 DUF3265 domain-containing protein -
OC617_RS16025 (CNRVC190243H_03148) 418678..419154 + 477 WP_001047180.1 GNAT family N-acetyltransferase -
OC617_RS16030 (CNRVC190243H_03149) 419345..419806 + 462 WP_001911752.1 lipocalin family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Genomic island catB9 - 349905..456410 106505
inside Integron catB9 - 354985..456034 101049


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin HigB-1

(2-95)

Antitoxin

Cro/C1-type helix-turn-helix domain

(12-69)


Sequences

Toxin        


Download         Length: 96 a.a.        Molecular weight: 11349.95 Da        Isoelectric Point: 6.7187

>T295393 WP_001162670.1 NZ_OW443148:414600-414887 [Vibrio cholerae]
MALEFKDKWLEQFYEDDKRHRLIPSSIENALFRKLEILDAAQAESDLRIPPGNRFEHLEGNLKGWCSIRVNKQYRLIFQW
VDGVALNTYLDPHKY

Download         Length: 288 bp

Antitoxin


Download         Length: 106 a.a.        Molecular weight: 11705.63 Da        Isoelectric Point: 10.4711

>AT295393 WP_001232701.1 NZ_OW443148:414898-415215 [Vibrio cholerae]
MRKTKRRPVSVGEMLKVEFLEPMGITSKALAEAMGVHRNTVSNLINGGVLTAPVAIKLAAALGNTPEFWLNIQHAVDLWD
TRNRYQEEAKFVKPLFVSLEQSART

Download         Length: 318 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0F2HI36

Antitoxin

Source ID Structure

References