Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | parDE/ParE-Phd |
| Location | 366545..367123 | Replicon | chromosome |
| Accession | NZ_OW443148 | ||
| Organism | Vibrio cholerae strain CNRVC190243 isolate YE-NCPHL-19014-PI | ||
Toxin (Protein)
| Gene name | parE | Uniprot ID | O68848 |
| Locus tag | OC617_RS15470 | Protein ID | WP_001180243.1 |
| Coordinates | 366545..366862 (-) | Length | 106 a.a. |
Antitoxin (Protein)
| Gene name | parD | Uniprot ID | Q7DCR7 |
| Locus tag | OC617_RS15475 | Protein ID | WP_000557292.1 |
| Coordinates | 366881..367123 (-) | Length | 81 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OC617_RS15435 | 362069..362251 | + | 183 | WP_000923340.1 | DUF645 family protein | - |
| OC617_RS15440 | 362371..362433 | + | 63 | Protein_310 | acetyltransferase | - |
| OC617_RS15445 | 362605..362787 | + | 183 | WP_000923153.1 | DUF645 family protein | - |
| OC617_RS15450 (CNRVC190243H_03078) | 362982..363659 | + | 678 | WP_000254617.1 | HNH endonuclease signature motif containing protein | - |
| OC617_RS15455 (CNRVC190243H_03079) | 363821..365029 | + | 1209 | WP_000272282.1 | deoxyguanosinetriphosphate triphosphohydrolase family protein | - |
| OC617_RS15460 (CNRVC190243H_03080) | 365191..365895 | + | 705 | WP_000087610.1 | HNH endonuclease | - |
| OC617_RS15465 (CNRVC190243H_03081) | 366053..366391 | + | 339 | WP_000713853.1 | hypothetical protein | - |
| OC617_RS15470 (CNRVC190243H_03082) | 366545..366862 | - | 318 | WP_001180243.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| OC617_RS15475 (CNRVC190243H_03083) | 366881..367123 | - | 243 | WP_000557292.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
| OC617_RS15480 (CNRVC190243H_03084) | 367367..367753 | + | 387 | WP_001015867.1 | NUDIX hydrolase | - |
| OC617_RS15485 | 367810..367923 | + | 114 | WP_001900214.1 | hypothetical protein | - |
| OC617_RS15490 (CNRVC190243H_03085) | 367932..368153 | + | 222 | WP_032467793.1 | DUF1289 domain-containing protein | - |
| OC617_RS15495 (CNRVC190243H_03086) | 368411..368947 | + | 537 | WP_000469482.1 | GNAT family protein | - |
| OC617_RS15500 (CNRVC190243H_03087) | 369138..369599 | + | 462 | WP_001903091.1 | lipocalin family protein | - |
| OC617_RS15505 | 369664..369732 | + | 69 | Protein_323 | acetyltransferase | - |
| OC617_RS15510 (CNRVC190243H_03088) | 369749..370246 | - | 498 | WP_000982260.1 | GNAT family N-acetyltransferase | - |
| OC617_RS15515 (CNRVC190243H_03089) | 370243..370515 | - | 273 | WP_000246253.1 | DUF1778 domain-containing protein | - |
| OC617_RS15520 | 370908..371033 | + | 126 | WP_001900195.1 | DUF645 family protein | - |
| OC617_RS15525 (CNRVC190243H_03090) | 371283..371729 | + | 447 | WP_000006157.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | catB9 | - | 349905..456410 | 106505 | |
| inside | Integron | catB9 | - | 354985..456034 | 101049 | ||
| - | flank | IS/Tn | - | - | 371792..373003 | 1211 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 106 a.a. Molecular weight: 12158.97 Da Isoelectric Point: 9.7495
>T295386 WP_001180243.1 NZ_OW443148:c366862-366545 [Vibrio cholerae]
MQNKQYKLSQLAQEHLLKIKHYTIENFAEAQWQKYKSTLLSGFQTLADNPGLGKSCEDIYQNGFYFPVGKHMAYYTKEAN
FILIVAVLGQSQLPQKHLKQSRFVS
MQNKQYKLSQLAQEHLLKIKHYTIENFAEAQWQKYKSTLLSGFQTLADNPGLGKSCEDIYQNGFYFPVGKHMAYYTKEAN
FILIVAVLGQSQLPQKHLKQSRFVS
Download Length: 318 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0K9UJR8 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | Q7DCR7 |