295386

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) parDE/ParE-Phd
Location 366545..367123 Replicon chromosome
Accession NZ_OW443148
Organism Vibrio cholerae strain CNRVC190243 isolate YE-NCPHL-19014-PI

Toxin (Protein)


Gene name parE Uniprot ID O68848
Locus tag OC617_RS15470 Protein ID WP_001180243.1
Coordinates 366545..366862 (-) Length 106 a.a.

Antitoxin (Protein)


Gene name parD Uniprot ID Q7DCR7
Locus tag OC617_RS15475 Protein ID WP_000557292.1
Coordinates 366881..367123 (-) Length 81 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OC617_RS15435 362069..362251 + 183 WP_000923340.1 DUF645 family protein -
OC617_RS15440 362371..362433 + 63 Protein_310 acetyltransferase -
OC617_RS15445 362605..362787 + 183 WP_000923153.1 DUF645 family protein -
OC617_RS15450 (CNRVC190243H_03078) 362982..363659 + 678 WP_000254617.1 HNH endonuclease signature motif containing protein -
OC617_RS15455 (CNRVC190243H_03079) 363821..365029 + 1209 WP_000272282.1 deoxyguanosinetriphosphate triphosphohydrolase family protein -
OC617_RS15460 (CNRVC190243H_03080) 365191..365895 + 705 WP_000087610.1 HNH endonuclease -
OC617_RS15465 (CNRVC190243H_03081) 366053..366391 + 339 WP_000713853.1 hypothetical protein -
OC617_RS15470 (CNRVC190243H_03082) 366545..366862 - 318 WP_001180243.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
OC617_RS15475 (CNRVC190243H_03083) 366881..367123 - 243 WP_000557292.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
OC617_RS15480 (CNRVC190243H_03084) 367367..367753 + 387 WP_001015867.1 NUDIX hydrolase -
OC617_RS15485 367810..367923 + 114 WP_001900214.1 hypothetical protein -
OC617_RS15490 (CNRVC190243H_03085) 367932..368153 + 222 WP_032467793.1 DUF1289 domain-containing protein -
OC617_RS15495 (CNRVC190243H_03086) 368411..368947 + 537 WP_000469482.1 GNAT family protein -
OC617_RS15500 (CNRVC190243H_03087) 369138..369599 + 462 WP_001903091.1 lipocalin family protein -
OC617_RS15505 369664..369732 + 69 Protein_323 acetyltransferase -
OC617_RS15510 (CNRVC190243H_03088) 369749..370246 - 498 WP_000982260.1 GNAT family N-acetyltransferase -
OC617_RS15515 (CNRVC190243H_03089) 370243..370515 - 273 WP_000246253.1 DUF1778 domain-containing protein -
OC617_RS15520 370908..371033 + 126 WP_001900195.1 DUF645 family protein -
OC617_RS15525 (CNRVC190243H_03090) 371283..371729 + 447 WP_000006157.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Genomic island catB9 - 349905..456410 106505
inside Integron catB9 - 354985..456034 101049
- flank IS/Tn - - 371792..373003 1211


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(6-93)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-71)


Sequences

Toxin        


Download         Length: 106 a.a.        Molecular weight: 12158.97 Da        Isoelectric Point: 9.7495

>T295386 WP_001180243.1 NZ_OW443148:c366862-366545 [Vibrio cholerae]
MQNKQYKLSQLAQEHLLKIKHYTIENFAEAQWQKYKSTLLSGFQTLADNPGLGKSCEDIYQNGFYFPVGKHMAYYTKEAN
FILIVAVLGQSQLPQKHLKQSRFVS

Download         Length: 318 bp

Antitoxin


Download         Length: 81 a.a.        Molecular weight: 8961.25 Da        Isoelectric Point: 5.6630

>AT295386 WP_000557292.1 NZ_OW443148:c367123-366881 [Vibrio cholerae]
MHTLTANDAKRNFGELLLSAQREPVIISKNSKNTVVVMSIKDFEELEAMKLDYLKHCFESAQKDLDSGKTVDGATFLNTL

Download         Length: 243 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0K9UJR8

Antitoxin

Source ID Structure
AlphaFold DB Q7DCR7

References