Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | /GNAT-DUF1778 |
Location | 945890..946656 | Replicon | chromosome |
Accession | NZ_CP080466 | ||
Organism | Vibrio cholerae strain ICDC-VC3741 |
Toxin (Protein)
Gene name | - | Uniprot ID | Q9K2P7 |
Locus tag | K1T75_RS17890 | Protein ID | WP_000982260.1 |
Coordinates | 946159..946656 (+) | Length | 166 a.a. |
Antitoxin (Protein)
Gene name | - | Uniprot ID | Q9K2J6 |
Locus tag | K1T75_RS17885 | Protein ID | WP_000246253.1 |
Coordinates | 945890..946162 (+) | Length | 91 a.a. |
Genomic Context
Location: 945890..946162 (273 bp)
Type: Antitoxin
Protein ID: WP_000246253.1
Type: Antitoxin
Protein ID: WP_000246253.1
Location: 946159..946656 (498 bp)
Type: Toxin
Protein ID: WP_000982260.1
Type: Toxin
Protein ID: WP_000982260.1
Location: 941118..942035 (918 bp)
Type: Others
Protein ID: WP_000186333.1
Type: Others
Protein ID: WP_000186333.1
Location: 942269..942571 (303 bp)
Type: Others
Protein ID: WP_000229317.1
Type: Others
Protein ID: WP_000229317.1
Location: 942559..942816 (258 bp)
Type: Others
Protein ID: WP_000861987.1
Type: Others
Protein ID: WP_000861987.1
Location: 942898..943008 (111 bp)
Type: Others
Protein ID: WP_086010065.1
Type: Others
Protein ID: WP_086010065.1
Location: 943018..943551 (534 bp)
Type: Others
Protein ID: WP_000118351.1
Type: Others
Protein ID: WP_000118351.1
Location: 943548..943817 (270 bp)
Type: Others
Protein ID: WP_000179600.1
Type: Others
Protein ID: WP_000179600.1
Location: 944040..944411 (372 bp)
Type: Others
Protein ID: WP_001164080.1
Type: Others
Protein ID: WP_001164080.1
Location: 944552..944839 (288 bp)
Type: Others
Protein ID: WP_000426470.1
Type: Others
Protein ID: WP_000426470.1
Location: 944991..945659 (669 bp)
Type: Others
Protein ID: WP_000043871.1
Type: Others
Protein ID: WP_000043871.1
Location: 945676..945738 (63 bp)
Type: Others
Protein ID: Protein_821
Type: Others
Protein ID: Protein_821
Location: 946673..946741 (69 bp)
Type: Others
Protein ID: Protein_824
Type: Others
Protein ID: Protein_824
Location: 946858..946962 (105 bp)
Type: Others
Protein ID: WP_228840819.1
Type: Others
Protein ID: WP_228840819.1
Location: 947153..947275 (123 bp)
Type: Others
Protein ID: Protein_826
Type: Others
Protein ID: Protein_826
Location: 947332..947787 (456 bp)
Type: Others
Protein ID: WP_001245327.1
Type: Others
Protein ID: WP_001245327.1
Location: 947915..948202 (288 bp)
Type: Others
Protein ID: WP_000221354.1
Type: Others
Protein ID: WP_000221354.1
Location: 948192..948443 (252 bp)
Type: Others
Protein ID: WP_001250179.1
Type: Others
Protein ID: WP_001250179.1
Location: 948657..949070 (414 bp)
Type: Others
Protein ID: WP_000049417.1
Type: Others
Protein ID: WP_000049417.1
Location: 949145..949255 (111 bp)
Type: Others
Protein ID: WP_082798255.1
Type: Others
Protein ID: WP_082798255.1
Location: 949258..949659 (402 bp)
Type: Others
Protein ID: WP_000351248.1
Type: Others
Protein ID: WP_000351248.1
Location: 949659..949829 (171 bp)
Type: Others
Protein ID: WP_001080654.1
Type: Others
Protein ID: WP_001080654.1
Location: 949953..950351 (399 bp)
Type: Others
Protein ID: Protein_834
Type: Others
Protein ID: Protein_834
Location: 950488..950794 (307 bp)
Type: Others
Protein ID: Protein_835
Type: Others
Protein ID: Protein_835
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
K1T75_RS17845 | 941118..942035 | - | 918 | WP_000186333.1 | alpha/beta hydrolase | - |
K1T75_RS17850 | 942269..942571 | - | 303 | WP_000229317.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
K1T75_RS17855 | 942559..942816 | - | 258 | WP_000861987.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | - |
K1T75_RS18835 | 942898..943008 | - | 111 | WP_086010065.1 | DUF3265 domain-containing protein | - |
K1T75_RS17860 | 943018..943551 | - | 534 | WP_000118351.1 | GNAT family N-acetyltransferase | - |
K1T75_RS18840 | 943548..943817 | - | 270 | WP_000179600.1 | DUF1778 domain-containing protein | - |
K1T75_RS17870 | 944040..944411 | - | 372 | WP_001164080.1 | MazG nucleotide pyrophosphohydrolase domain-containing protein | - |
K1T75_RS17875 | 944552..944839 | - | 288 | WP_000426470.1 | hypothetical protein | - |
K1T75_RS17880 | 944991..945659 | - | 669 | WP_000043871.1 | hypothetical protein | - |
K1T75_RS18845 | 945676..945738 | - | 63 | Protein_821 | acetyltransferase | - |
K1T75_RS17885 | 945890..946162 | + | 273 | WP_000246253.1 | DUF1778 domain-containing protein | Antitoxin |
K1T75_RS17890 | 946159..946656 | + | 498 | WP_000982260.1 | GNAT family N-acetyltransferase | Toxin |
K1T75_RS18850 | 946673..946741 | - | 69 | Protein_824 | acetyltransferase | - |
K1T75_RS17895 | 946858..946962 | - | 105 | WP_228840819.1 | DUF645 family protein | - |
K1T75_RS18855 | 947153..947275 | - | 123 | Protein_826 | acetyltransferase | - |
K1T75_RS17900 | 947332..947787 | - | 456 | WP_001245327.1 | GNAT family N-acetyltransferase | - |
K1T75_RS17905 | 947915..948202 | - | 288 | WP_000221354.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
K1T75_RS17910 | 948192..948443 | - | 252 | WP_001250179.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | - |
K1T75_RS17915 | 948657..949070 | - | 414 | WP_000049417.1 | VOC family protein | - |
K1T75_RS18860 | 949145..949255 | - | 111 | WP_082798255.1 | DUF3265 domain-containing protein | - |
K1T75_RS17920 | 949258..949659 | - | 402 | WP_000351248.1 | type II toxin-antitoxin system death-on-curing family toxin | - |
K1T75_RS18865 | 949659..949829 | - | 171 | WP_001080654.1 | hypothetical protein | - |
K1T75_RS18870 | 949953..950351 | - | 399 | Protein_834 | GNAT family N-acetyltransferase | - |
K1T75_RS17930 | 950488..950794 | - | 307 | Protein_835 | CatB-related O-acetyltransferase | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | catB9 | - | 932680..1039634 | 106954 | |
inside | Integron | - | - | 933056..1032792 | 99736 | ||
flank | IS/Tn | - | - | 950862..951842 | 980 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 166 a.a. Molecular weight: 18527.18 Da Isoelectric Point: 8.7753
>T211910 WP_000982260.1 NZ_CP080466:946159-946656 [Vibrio cholerae]
MMNTVLLDKDKHDRNRFNCGTEALNNYLKVMASQQAKKDNTRTFVLEDDNNSAYIIGFYTLTMTPIDLKALPDKLQKKHQ
SSTSGGLIARLAVDDRYKGKGFGEWLLIDALRKLLAASDSVAFPVVIVDAKDGAKHFYERYGFQAFQDAENKLFITIADI
RASLG
MMNTVLLDKDKHDRNRFNCGTEALNNYLKVMASQQAKKDNTRTFVLEDDNNSAYIIGFYTLTMTPIDLKALPDKLQKKHQ
SSTSGGLIARLAVDDRYKGKGFGEWLLIDALRKLLAASDSVAFPVVIVDAKDGAKHFYERYGFQAFQDAENKLFITIADI
RASLG
Download Length: 498 bp
>T211910 NZ_CP106838:4241481-4241584 [Klebsiella michiganensis]
GGCAAGGCGACTTAGCCTGCATTAATGCCAACTTTTAGCGCACGGCTCTCTCCCAAGAGCCATTTCCCTGGACCGAATAC
AGGAATCGTGTTCGGTCTCTTTTT
GGCAAGGCGACTTAGCCTGCATTAATGCCAACTTTTAGCGCACGGCTCTCTCCCAAGAGCCATTTCCCTGGACCGAATAC
AGGAATCGTGTTCGGTCTCTTTTT
Antitoxin
Download Length: 91 a.a. Molecular weight: 9683.22 Da Isoelectric Point: 6.2988
>AT211910 WP_000246253.1 NZ_CP080466:945890-946162 [Vibrio cholerae]
MATTLPRITARVDVDTQDLLAKAAALAGMSSINSFVLNAAIEKAKQVIEREQALKLSQADAVLLMEALDNPAVVNAKLKL
ASERYESKTQ
MATTLPRITARVDVDTQDLLAKAAALAGMSSINSFVLNAAIEKAKQVIEREQALKLSQADAVLLMEALDNPAVVNAKLKL
ASERYESKTQ
Download Length: 273 bp
>AT211910 NZ_CP106838:c4241591-4241423 [Klebsiella michiganensis]
AACAGATAAAAAGAGACCGAACACGATTCCTGTATTCGGTCCAGGGAAATGGCTCTTGGGAGAGAGCCGTGCGCTAAAAG
TTGGCATTAATGCAGGCTAAGTCGCCTTGCCTTATAAGAATAGTTTACCGTGTCAGGTTTTCCAGTCCGCGACAAAAGTG
GACGAATAA
AACAGATAAAAAGAGACCGAACACGATTCCTGTATTCGGTCCAGGGAAATGGCTCTTGGGAGAGAGCCGTGCGCTAAAAG
TTGGCATTAATGCAGGCTAAGTCGCCTTGCCTTATAAGAATAGTTTACCGTGTCAGGTTTTCCAGTCCGCGACAAAAGTG
GACGAATAA
Structures
Toxin
Loading, please wait
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0Q0KGB1 |
Antitoxin
Loading, please wait
Source | ID | Structure |
---|---|---|
PDB | 1Y9B | |
AlphaFold DB | A0A0F2IC79 |