Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | relBE/ParE-YafN |
Location | 141998..142526 | Replicon | chromosome |
Accession | NZ_CP033513 | ||
Organism | Vibrio cholerae strain E4 |
Toxin (Protein)
Gene name | relE | Uniprot ID | A0A0X1KZS6 |
Locus tag | EEL44_RS00715 | Protein ID | WP_000221354.1 |
Coordinates | 141998..142285 (-) | Length | 96 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | A0A0X1KZS8 |
Locus tag | EEL44_RS00720 | Protein ID | WP_001250179.1 |
Coordinates | 142275..142526 (-) | Length | 84 a.a. |
Genomic Context
Location: 139973..140245 (273 bp)
Type: Others
Protein ID: WP_000246253.1
Type: Others
Protein ID: WP_000246253.1
Location: 140242..140739 (498 bp)
Type: Others
Protein ID: WP_000982260.1
Type: Others
Protein ID: WP_000982260.1
Location: 144945..145925 (981 bp)
Type: Others
Protein ID: WP_000019370.1
Type: Others
Protein ID: WP_000019370.1
Location: 137101..137634 (534 bp)
Type: Others
Protein ID: WP_000118351.1
Type: Others
Protein ID: WP_000118351.1
Location: 137631..138056 (426 bp)
Type: Others
Protein ID: WP_001882332.1
Type: Others
Protein ID: WP_001882332.1
Location: 138123..138494 (372 bp)
Type: Others
Protein ID: WP_001164080.1
Type: Others
Protein ID: WP_001164080.1
Location: 138635..138922 (288 bp)
Type: Others
Protein ID: WP_000426470.1
Type: Others
Protein ID: WP_000426470.1
Location: 139074..139742 (669 bp)
Type: Others
Protein ID: WP_000043871.1
Type: Others
Protein ID: WP_000043871.1
Location: 140941..141093 (153 bp)
Type: Others
Protein ID: WP_001884520.1
Type: Others
Protein ID: WP_001884520.1
Location: 141415..141870 (456 bp)
Type: Others
Protein ID: WP_001245327.1
Type: Others
Protein ID: WP_001245327.1
Location: 141998..142285 (288 bp)
Type: Toxin
Protein ID: WP_000221354.1
Type: Toxin
Protein ID: WP_000221354.1
Location: 142275..142526 (252 bp)
Type: Antitoxin
Protein ID: WP_001250179.1
Type: Antitoxin
Protein ID: WP_001250179.1
Location: 142740..143153 (414 bp)
Type: Others
Protein ID: WP_000049417.1
Type: Others
Protein ID: WP_000049417.1
Location: 143228..143371 (144 bp)
Type: Others
Protein ID: WP_071908341.1
Type: Others
Protein ID: WP_071908341.1
Location: 143341..143742 (402 bp)
Type: Others
Protein ID: WP_000351248.1
Type: Others
Protein ID: WP_000351248.1
Location: 143742..144434 (693 bp)
Type: Others
Protein ID: WP_001047169.1
Type: Others
Protein ID: WP_001047169.1
Location: 144571..144877 (307 bp)
Type: Others
Protein ID: Protein_138
Type: Others
Protein ID: Protein_138
Location: 146050..146205 (156 bp)
Type: Others
Protein ID: WP_000751734.1
Type: Others
Protein ID: WP_000751734.1
Location: 146373..146807 (435 bp)
Type: Others
Protein ID: WP_000256036.1
Type: Others
Protein ID: WP_000256036.1
Location: 146944..147258 (315 bp)
Type: Others
Protein ID: WP_000071008.1
Type: Others
Protein ID: WP_000071008.1
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
EEL44_RS00665 | 137101..137634 | - | 534 | WP_000118351.1 | GNAT family N-acetyltransferase | - |
EEL44_RS00670 | 137631..138056 | - | 426 | WP_001882332.1 | DUF1778 domain-containing protein | - |
EEL44_RS00675 | 138123..138494 | - | 372 | WP_001164080.1 | nucleotide pyrophosphohydrolase | - |
EEL44_RS00680 | 138635..138922 | - | 288 | WP_000426470.1 | hypothetical protein | - |
EEL44_RS00685 | 139074..139742 | - | 669 | WP_000043871.1 | hypothetical protein | - |
EEL44_RS00690 | 139973..140245 | + | 273 | WP_000246253.1 | DUF1778 domain-containing protein | - |
EEL44_RS00695 | 140242..140739 | + | 498 | WP_000982260.1 | GNAT family N-acetyltransferase | - |
EEL44_RS00705 | 140941..141093 | - | 153 | WP_001884520.1 | DUF645 family protein | - |
EEL44_RS00710 | 141415..141870 | - | 456 | WP_001245327.1 | GNAT family N-acetyltransferase | - |
EEL44_RS00715 | 141998..142285 | - | 288 | WP_000221354.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
EEL44_RS00720 | 142275..142526 | - | 252 | WP_001250179.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
EEL44_RS00725 | 142740..143153 | - | 414 | WP_000049417.1 | VOC family protein | - |
EEL44_RS00730 | 143228..143371 | - | 144 | WP_071908341.1 | DUF3265 domain-containing protein | - |
EEL44_RS00735 | 143341..143742 | - | 402 | WP_000351248.1 | type II toxin-antitoxin system death-on-curing family toxin | - |
EEL44_RS00740 | 143742..144434 | - | 693 | WP_001047169.1 | GNAT family N-acetyltransferase | - |
EEL44_RS00745 | 144571..144877 | - | 307 | Protein_138 | CatB-related O-acetyltransferase | - |
EEL44_RS00750 | 144945..145925 | + | 981 | WP_000019370.1 | IS5-like element ISVch5 family transposase | - |
EEL44_RS20945 | 146050..146205 | - | 156 | WP_000751734.1 | hypothetical protein | - |
EEL44_RS00755 | 146373..146807 | - | 435 | WP_000256036.1 | GNAT family N-acetyltransferase | - |
EEL44_RS00760 | 146944..147258 | - | 315 | WP_000071008.1 | DNA-binding transcriptional regulator | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | catB9 | - | 126763..233717 | 106954 | |
inside | Integron | - | - | 127139..226875 | 99736 | ||
flank | IS/Tn | - | - | 144945..145925 | 980 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 96 a.a. Molecular weight: 10991.96 Da Isoelectric Point: 10.4934
>T113800 WP_000221354.1 NZ_CP033513:c142285-141998 [Vibrio cholerae]
MTYKLKFLPAAQKEWSKLAPTIQSQFKKKLKERLENPHVPSAKLRGYDAVYKIKLRTAGYRLAYEVIDDEIVVYVLAVGK
RDKDAVYKKLASRFG
MTYKLKFLPAAQKEWSKLAPTIQSQFKKKLKERLENPHVPSAKLRGYDAVYKIKLRTAGYRLAYEVIDDEIVVYVLAVGK
RDKDAVYKKLASRFG
Download Length: 288 bp
>T113800 NZ_CP033513:c142285-141998 [Vibrio cholerae]
ATGACCTATAAGTTAAAGTTTCTGCCGGCTGCGCAAAAGGAATGGAGTAAGTTAGCTCCGACAATTCAGAGTCAGTTCAA
GAAGAAGTTAAAGGAACGATTAGAAAATCCGCACGTCCCTTCGGCTAAGCTTCGAGGATACGACGCTGTTTACAAGATTA
AACTTCGTACGGCGGGTTATCGTTTAGCTTATGAGGTTATTGACGATGAGATAGTTGTCTATGTCCTTGCTGTCGGTAAA
CGTGACAAAGATGCTGTCTATAAAAAACTGGCTTCACGCTTCGGTTAG
ATGACCTATAAGTTAAAGTTTCTGCCGGCTGCGCAAAAGGAATGGAGTAAGTTAGCTCCGACAATTCAGAGTCAGTTCAA
GAAGAAGTTAAAGGAACGATTAGAAAATCCGCACGTCCCTTCGGCTAAGCTTCGAGGATACGACGCTGTTTACAAGATTA
AACTTCGTACGGCGGGTTATCGTTTAGCTTATGAGGTTATTGACGATGAGATAGTTGTCTATGTCCTTGCTGTCGGTAAA
CGTGACAAAGATGCTGTCTATAAAAAACTGGCTTCACGCTTCGGTTAG
Antitoxin
Download Length: 84 a.a. Molecular weight: 9136.29 Da Isoelectric Point: 4.0197
>AT113800 WP_001250179.1 NZ_CP033513:c142526-142275 [Vibrio cholerae]
MRQVLANCSASISELKKNPTALLNEADGSAIAILNHNKPAAYLVPAETYEYLIDMLDDYELSQIVDSRRADLAQAVEVNI
DDL
MRQVLANCSASISELKKNPTALLNEADGSAIAILNHNKPAAYLVPAETYEYLIDMLDDYELSQIVDSRRADLAQAVEVNI
DDL
Download Length: 252 bp
>AT113800 NZ_CP033513:c142526-142275 [Vibrio cholerae]
ATGAGACAAGTTTTAGCGAATTGCTCTGCAAGTATTTCAGAGTTAAAGAAGAACCCAACAGCTTTGTTGAATGAGGCTGA
TGGGTCTGCAATTGCAATTTTAAACCACAACAAGCCAGCGGCTTACCTTGTGCCAGCGGAAACGTATGAGTATCTCATCG
ATATGCTCGATGATTATGAGCTTTCCCAAATTGTCGATAGTCGCCGAGCTGACTTAGCACAAGCTGTGGAAGTAAATATT
GATGACCTATAA
ATGAGACAAGTTTTAGCGAATTGCTCTGCAAGTATTTCAGAGTTAAAGAAGAACCCAACAGCTTTGTTGAATGAGGCTGA
TGGGTCTGCAATTGCAATTTTAAACCACAACAAGCCAGCGGCTTACCTTGTGCCAGCGGAAACGTATGAGTATCTCATCG
ATATGCTCGATGATTATGAGCTTTCCCAAATTGTCGATAGTCGCCGAGCTGACTTAGCACAAGCTGTGGAAGTAAATATT
GATGACCTATAA
Structures
Toxin
Loading, please wait
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0X1KZS6 |
Antitoxin
Loading, please wait
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0X1KZS8 |