Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/ParE-YafN |
| Location | 399293..399821 | Replicon | chromosome |
| Accession | NZ_LT906615 | ||
| Organism | Vibrio cholerae O1 biovar El Tor str. N16961 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | H9L4R3 |
| Locus tag | FY484_RS16190 | Protein ID | WP_000221352.1 |
| Coordinates | 399293..399583 (-) | Length | 97 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | H9L4T4 |
| Locus tag | FY484_RS16195 | Protein ID | WP_000213183.1 |
| Coordinates | 399573..399821 (-) | Length | 83 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| FY484_RS19535 | 394850..394975 | + | 126 | WP_001944767.1 | DUF645 family protein | - |
| FY484_RS19540 | 394991..395029 | + | 39 | WP_106019119.1 | hypothetical protein | - |
| FY484_RS16160 | 395242..396246 | + | 1005 | WP_000964925.1 | LD-carboxypeptidase | - |
| FY484_RS16165 | 396399..396845 | + | 447 | WP_000128977.1 | hypothetical protein | - |
| FY484_RS16170 | 396965..397894 | + | 930 | WP_000335802.1 | hypothetical protein | - |
| FY484_RS16175 | 397891..398001 | + | 111 | WP_071917832.1 | DUF3265 domain-containing protein | - |
| FY484_RS16180 | 398029..398505 | + | 477 | WP_001047180.1 | GNAT family N-acetyltransferase | - |
| FY484_RS16185 | 398642..399157 | + | 516 | WP_001201528.1 | lipocalin family protein | - |
| FY484_RS16190 | 399293..399583 | - | 291 | WP_000221352.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| FY484_RS16195 | 399573..399821 | - | 249 | WP_000213183.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
| FY484_RS16210 | 400392..401045 | + | 654 | WP_000036957.1 | site-specific DNA-methyltransferase | - |
| FY484_RS16215 | 401317..401742 | + | 426 | WP_000415748.1 | hypothetical protein | - |
| FY484_RS16220 | 401950..402345 | + | 396 | WP_000649527.1 | DUF3465 domain-containing protein | - |
| FY484_RS16225 | 402496..403026 | + | 531 | WP_000415563.1 | hypothetical protein | - |
| FY484_RS16230 | 403164..403664 | + | 501 | WP_000789723.1 | hypothetical protein | - |
| FY484_RS16240 | 403820..404218 | + | 399 | WP_001882293.1 | hypothetical protein | - |
| FY484_RS16245 | 404318..404782 | - | 465 | WP_000140244.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | catB9 | - | 304666..435761 | 131095 | |
| inside | Integron | catB9 | - | 309746..435385 | 125639 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 97 a.a. Molecular weight: 11247.23 Da Isoelectric Point: 10.4678
>T293800 WP_000221352.1 NZ_LT906615:c399583-399293 [Vibrio cholerae O1 biovar El Tor str. N16961]
MTYKLEFKKSALKEWKKLAVPLQQQFKKKLIERLENPHVPSAKLSGAENIYKIKLRQSGYRLVYQVENDIIVVTVLAVGK
RERSEVYTKALQRLDD
MTYKLEFKKSALKEWKKLAVPLQQQFKKKLIERLENPHVPSAKLSGAENIYKIKLRQSGYRLVYQVENDIIVVTVLAVGK
RERSEVYTKALQRLDD
Download Length: 291 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | H9L4R3 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A366A3W8 |