293800

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/ParE-YafN
Location 399293..399821 Replicon chromosome
Accession NZ_LT906615
Organism Vibrio cholerae O1 biovar El Tor str. N16961

Toxin (Protein)


Gene name relE Uniprot ID H9L4R3
Locus tag FY484_RS16190 Protein ID WP_000221352.1
Coordinates 399293..399583 (-) Length 97 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID H9L4T4
Locus tag FY484_RS16195 Protein ID WP_000213183.1
Coordinates 399573..399821 (-) Length 83 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
FY484_RS19535 394850..394975 + 126 WP_001944767.1 DUF645 family protein -
FY484_RS19540 394991..395029 + 39 WP_106019119.1 hypothetical protein -
FY484_RS16160 395242..396246 + 1005 WP_000964925.1 LD-carboxypeptidase -
FY484_RS16165 396399..396845 + 447 WP_000128977.1 hypothetical protein -
FY484_RS16170 396965..397894 + 930 WP_000335802.1 hypothetical protein -
FY484_RS16175 397891..398001 + 111 WP_071917832.1 DUF3265 domain-containing protein -
FY484_RS16180 398029..398505 + 477 WP_001047180.1 GNAT family N-acetyltransferase -
FY484_RS16185 398642..399157 + 516 WP_001201528.1 lipocalin family protein -
FY484_RS16190 399293..399583 - 291 WP_000221352.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
FY484_RS16195 399573..399821 - 249 WP_000213183.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
FY484_RS16210 400392..401045 + 654 WP_000036957.1 site-specific DNA-methyltransferase -
FY484_RS16215 401317..401742 + 426 WP_000415748.1 hypothetical protein -
FY484_RS16220 401950..402345 + 396 WP_000649527.1 DUF3465 domain-containing protein -
FY484_RS16225 402496..403026 + 531 WP_000415563.1 hypothetical protein -
FY484_RS16230 403164..403664 + 501 WP_000789723.1 hypothetical protein -
FY484_RS16240 403820..404218 + 399 WP_001882293.1 hypothetical protein -
FY484_RS16245 404318..404782 - 465 WP_000140244.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Genomic island catB9 - 304666..435761 131095
inside Integron catB9 - 309746..435385 125639


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(4-86)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 97 a.a.        Molecular weight: 11247.23 Da        Isoelectric Point: 10.4678

>T293800 WP_000221352.1 NZ_LT906615:c399583-399293 [Vibrio cholerae O1 biovar El Tor str. N16961]
MTYKLEFKKSALKEWKKLAVPLQQQFKKKLIERLENPHVPSAKLSGAENIYKIKLRQSGYRLVYQVENDIIVVTVLAVGK
RERSEVYTKALQRLDD

Download         Length: 291 bp

Antitoxin


Download         Length: 83 a.a.        Molecular weight: 8937.28 Da        Isoelectric Point: 4.1079

>AT293800 WP_000213183.1 NZ_LT906615:c399821-399573 [Vibrio cholerae O1 biovar El Tor str. N16961]
MTTRILADVAASITEFKANPMKVATSAFGAPVAVLNRNEPAFYCVPASTYEIMMDKLEDLELLAIAKERLSEDSVSVNID
DL

Download         Length: 249 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB H9L4R3

Antitoxin

Source ID Structure
AlphaFold DB A0A366A3W8

References