Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/RelE-MqsA |
Location | 116728..117361 | Replicon | chromosome |
Accession | NZ_CP007635 | ||
Organism | Vibrio cholerae strain 2012EL-2176 |
Toxin (Protein)
Gene name | higB | Uniprot ID | Q9KMA6 |
Locus tag | EN18_RS14905 | Protein ID | WP_000843587.1 |
Coordinates | 116728..117060 (+) | Length | 111 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | EN18_RS14910 | Protein ID | WP_000071008.1 |
Coordinates | 117047..117361 (+) | Length | 105 a.a. |
Genomic Context
Location: 112169..112372 (204 bp)
Type: Others
Protein ID: WP_001911745.1
Type: Others
Protein ID: WP_001911745.1
Location: 112653..112826 (174 bp)
Type: Others
Protein ID: WP_001882305.1
Type: Others
Protein ID: WP_001882305.1
Location: 113186..113455 (270 bp)
Type: Others
Protein ID: WP_001198131.1
Type: Others
Protein ID: WP_001198131.1
Location: 113773..113944 (172 bp)
Type: Others
Protein ID: Protein_170
Type: Others
Protein ID: Protein_170
Location: 114153..114539 (387 bp)
Type: Others
Protein ID: WP_000703163.1
Type: Others
Protein ID: WP_000703163.1
Location: 114741..114983 (243 bp)
Type: Others
Protein ID: WP_000107461.1
Type: Others
Protein ID: WP_000107461.1
Location: 115154..115531 (378 bp)
Type: Others
Protein ID: WP_000411109.1
Type: Others
Protein ID: WP_000411109.1
Location: 115588..115702 (115 bp)
Type: Others
Protein ID: Protein_174
Type: Others
Protein ID: Protein_174
Location: 115651..115932 (282 bp)
Type: Others
Protein ID: WP_001894453.1
Type: Others
Protein ID: WP_001894453.1
Location: 116098..116211 (114 bp)
Type: Others
Protein ID: WP_001889158.1
Type: Others
Protein ID: WP_001889158.1
Location: 116160..116387 (228 bp)
Type: Others
Protein ID: WP_073426587.1
Type: Others
Protein ID: WP_073426587.1
Location: 116728..117060 (333 bp)
Type: Toxin
Protein ID: WP_000843587.1
Type: Toxin
Protein ID: WP_000843587.1
Location: 117047..117361 (315 bp)
Type: Antitoxin
Protein ID: WP_000071008.1
Type: Antitoxin
Protein ID: WP_000071008.1
Location: 117498..117932 (435 bp)
Type: Others
Protein ID: WP_000256036.1
Type: Others
Protein ID: WP_000256036.1
Location: 118100..118255 (156 bp)
Type: Others
Protein ID: WP_000751734.1
Type: Others
Protein ID: WP_000751734.1
Location: 119428..119734 (307 bp)
Type: Others
Protein ID: Protein_183
Type: Others
Protein ID: Protein_183
Location: 119871..120563 (693 bp)
Type: Others
Protein ID: WP_001047169.1
Type: Others
Protein ID: WP_001047169.1
Location: 120563..120964 (402 bp)
Type: Others
Protein ID: WP_000351248.1
Type: Others
Protein ID: WP_000351248.1
Location: 120934..121077 (144 bp)
Type: Others
Protein ID: WP_071908341.1
Type: Others
Protein ID: WP_071908341.1
Location: 121152..121565 (414 bp)
Type: Others
Protein ID: WP_000049417.1
Type: Others
Protein ID: WP_000049417.1
Location: 121779..122030 (252 bp)
Type: Others
Protein ID: WP_001250179.1
Type: Others
Protein ID: WP_001250179.1
Location: 122020..122307 (288 bp)
Type: Others
Protein ID: WP_000221354.1
Type: Others
Protein ID: WP_000221354.1
Location: 118380..119360 (981 bp)
Type: Others
Protein ID: WP_000019370.1
Type: Others
Protein ID: WP_000019370.1
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
EN18_RS21390 | 112169..112372 | + | 204 | WP_001911745.1 | hypothetical protein | - |
EN18_RS21210 | 112653..112826 | + | 174 | WP_001882305.1 | DUF3709 domain-containing protein | - |
EN18_RS14880 | 113186..113455 | + | 270 | WP_001198131.1 | hypothetical protein | - |
EN18_RS20690 | 113773..113944 | + | 172 | Protein_170 | DUF645 family protein | - |
EN18_RS14885 | 114153..114539 | + | 387 | WP_000703163.1 | VOC family protein | - |
EN18_RS14890 | 114741..114983 | + | 243 | WP_000107461.1 | hypothetical protein | - |
EN18_RS14895 | 115154..115531 | + | 378 | WP_000411109.1 | hypothetical protein | - |
EN18_RS21575 | 115588..115702 | + | 115 | Protein_174 | acetyltransferase | - |
EN18_RS20695 | 115651..115932 | + | 282 | WP_001894453.1 | DUF1289 domain-containing protein | - |
EN18_RS20710 | 116098..116211 | + | 114 | WP_001889158.1 | hypothetical protein | - |
EN18_RS20715 | 116160..116387 | + | 228 | WP_073426587.1 | DUF1289 domain-containing protein | - |
EN18_RS14905 | 116728..117060 | + | 333 | WP_000843587.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
EN18_RS14910 | 117047..117361 | + | 315 | WP_000071008.1 | DNA-binding transcriptional regulator | Antitoxin |
EN18_RS14915 | 117498..117932 | + | 435 | WP_000256036.1 | GNAT family N-acetyltransferase | - |
EN18_RS21395 | 118100..118255 | + | 156 | WP_000751734.1 | hypothetical protein | - |
EN18_RS14925 | 118380..119360 | - | 981 | WP_000019370.1 | IS5-like element ISVch5 family transposase | - |
EN18_RS14930 | 119428..119734 | + | 307 | Protein_183 | CatB-related O-acetyltransferase | - |
EN18_RS14935 | 119871..120563 | + | 693 | WP_001047169.1 | GNAT family N-acetyltransferase | - |
EN18_RS14940 | 120563..120964 | + | 402 | WP_000351248.1 | type II toxin-antitoxin system death-on-curing family toxin | - |
EN18_RS21220 | 120934..121077 | + | 144 | WP_071908341.1 | DUF3265 domain-containing protein | - |
EN18_RS14945 | 121152..121565 | + | 414 | WP_000049417.1 | VOC family protein | - |
EN18_RS14950 | 121779..122030 | + | 252 | WP_001250179.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | - |
EN18_RS14955 | 122020..122307 | + | 288 | WP_000221354.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | catB9 | - | 31037..137542 | 106505 | |
inside | Integron | - | - | 36117..137166 | 101049 | ||
flank | IS/Tn | - | - | 118380..119360 | 980 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 111 a.a. Molecular weight: 13005.95 Da Isoelectric Point: 9.9244
>T46758 WP_000843587.1 NZ_CP007635:116728-117060 [Vibrio cholerae]
MKSVFVESTIFEKYRDEYLSDEEYRLFQAELMLNPKLGDVIQGTGGLRKIRVASKGKGKRGGSRIIYYFLDEKRRFYLLT
IYGKNEMSDLNANQRKQLMAFMEAWRNEQS
MKSVFVESTIFEKYRDEYLSDEEYRLFQAELMLNPKLGDVIQGTGGLRKIRVASKGKGKRGGSRIIYYFLDEKRRFYLLT
IYGKNEMSDLNANQRKQLMAFMEAWRNEQS
Download Length: 333 bp
>T46758 NZ_CP007635:116728-117060 [Vibrio cholerae]
ATGAAAAGTGTATTTGTCGAATCAACAATTTTTGAAAAGTACCGAGATGAATATCTCAGTGATGAGGAGTATAGGCTCTT
TCAAGCAGAGCTAATGCTAAACCCCAAGCTGGGTGATGTGATTCAAGGTACTGGCGGTTTGCGAAAAATTCGAGTTGCGA
GTAAAGGCAAGGGAAAGCGTGGTGGTTCACGGATTATCTATTACTTTCTCGATGAAAAGAGGCGTTTCTATTTGCTAACC
ATTTACGGCAAAAATGAAATGTCTGACTTGAATGCAAATCAAAGGAAACAACTAATGGCTTTTATGGAGGCGTGGCGCAA
TGAGCAATCGTGA
ATGAAAAGTGTATTTGTCGAATCAACAATTTTTGAAAAGTACCGAGATGAATATCTCAGTGATGAGGAGTATAGGCTCTT
TCAAGCAGAGCTAATGCTAAACCCCAAGCTGGGTGATGTGATTCAAGGTACTGGCGGTTTGCGAAAAATTCGAGTTGCGA
GTAAAGGCAAGGGAAAGCGTGGTGGTTCACGGATTATCTATTACTTTCTCGATGAAAAGAGGCGTTTCTATTTGCTAACC
ATTTACGGCAAAAATGAAATGTCTGACTTGAATGCAAATCAAAGGAAACAACTAATGGCTTTTATGGAGGCGTGGCGCAA
TGAGCAATCGTGA
Antitoxin
Download Length: 105 a.a. Molecular weight: 11696.20 Da Isoelectric Point: 6.7600
>AT46758 WP_000071008.1 NZ_CP007635:117047-117361 [Vibrio cholerae]
MSNRDLFAELSSALVEAKQHSEGKLTLKTHHVNDVGELNISPDEIVSIREQFNMSRGVFARLLHTSSRTLENWEQGRSVP
NGQAVTLLKLVQRHPETLSHIAEL
MSNRDLFAELSSALVEAKQHSEGKLTLKTHHVNDVGELNISPDEIVSIREQFNMSRGVFARLLHTSSRTLENWEQGRSVP
NGQAVTLLKLVQRHPETLSHIAEL
Download Length: 315 bp
>AT46758 NZ_CP007635:117047-117361 [Vibrio cholerae]
ATGAGCAATCGTGATTTATTTGCAGAGTTAAGCTCAGCTCTTGTTGAGGCTAAGCAGCATTCAGAAGGTAAGCTTACTCT
GAAAACACATCATGTGAATGATGTGGGTGAGTTGAACATCTCACCGGATGAAATCGTGAGTATTCGCGAGCAGTTCAATA
TGTCCCGCGGAGTCTTCGCGCGGTTACTTCATACGTCTTCGCGCACATTAGAAAACTGGGAACAAGGTCGTAGTGTGCCA
AATGGTCAAGCGGTCACTCTTTTAAAGTTAGTACAGCGTCATCCAGAAACGTTGTCACACATAGCCGAGCTATAA
ATGAGCAATCGTGATTTATTTGCAGAGTTAAGCTCAGCTCTTGTTGAGGCTAAGCAGCATTCAGAAGGTAAGCTTACTCT
GAAAACACATCATGTGAATGATGTGGGTGAGTTGAACATCTCACCGGATGAAATCGTGAGTATTCGCGAGCAGTTCAATA
TGTCCCGCGGAGTCTTCGCGCGGTTACTTCATACGTCTTCGCGCACATTAGAAAACTGGGAACAAGGTCGTAGTGTGCCA
AATGGTCAAGCGGTCACTCTTTTAAAGTTAGTACAGCGTCATCCAGAAACGTTGTCACACATAGCCGAGCTATAA