254468

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) /BrnT(toxin)
Location 743072..743570 Replicon chromosome
Accession NZ_CP102928
Organism Vibrio cholerae strain N1252

Toxin (Protein)


Gene name - Uniprot ID Q9KMK7
Locus tag NW313_RS17240 Protein ID WP_000589156.1
Coordinates 743072..743338 (+) Length 89 a.a.

Antitoxin (Protein)


Gene name - Uniprot ID Q9KMK6
Locus tag NW313_RS17245 Protein ID WP_000643598.1
Coordinates 743325..743570 (+) Length 82 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NW313_RS17175 738601..738699 + 99 WP_223225486.1 DUF3709 domain-containing protein -
NW313_RS17180 738899..739000 + 102 WP_001921603.1 hypothetical protein -
NW313_RS17185 738990..739376 + 387 WP_000703163.1 VOC family protein -
NW313_RS17190 739571..739822 + 252 WP_001890111.1 TIGR03643 family protein -
NW313_RS17195 739795..739944 + 150 WP_071908333.1 DUF3265 domain-containing protein -
NW313_RS17200 740036..740278 + 243 WP_000107461.1 hypothetical protein -
NW313_RS17205 740530..740808 + 279 WP_000280324.1 DUF3709 domain-containing protein -
NW313_RS17210 741240..741283 + 44 Protein_665 hypothetical protein -
NW313_RS17215 741265..741358 + 94 Protein_666 ggdef family protein -
NW313_RS17220 741327..741458 + 132 WP_001883067.1 hypothetical protein -
NW313_RS17225 741630..742097 + 468 WP_001289288.1 OsmC family protein -
NW313_RS17230 742225..742887 + 663 WP_000960654.1 hypothetical protein -
NW313_RS17235 742877..743005 + 129 WP_088124358.1 DUF3265 domain-containing protein -
NW313_RS17240 743072..743338 + 267 WP_000589156.1 BrnT family toxin Toxin
NW313_RS17245 743325..743570 + 246 WP_000643598.1 hypothetical protein Antitoxin
NW313_RS17250 743666..744460 + 795 WP_001911581.1 hypothetical protein -
NW313_RS17255 744457..744573 + 117 WP_086010881.1 DUF3265 domain-containing protein -
NW313_RS17260 744563..744691 + 129 WP_071908338.1 general secretion pathway protein GspI -
NW313_RS17265 744752..744934 + 183 WP_000923182.1 DUF645 family protein -
NW313_RS17270 745150..746154 + 1005 WP_000964920.1 LD-carboxypeptidase -
NW313_RS17275 746307..746666 + 360 WP_001071541.1 VOC family protein -
NW313_RS17280 746733..746918 + 186 WP_001999468.1 hypothetical protein -
NW313_RS17285 747050..747172 + 123 WP_001937972.1 DUF3709 domain-containing protein -
NW313_RS17290 747440..747946 + 507 WP_000393074.1 hypothetical protein -
NW313_RS17295 748103..748489 + 387 WP_000703163.1 VOC family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Genomic island catB9 - 713852..820357 106505
inside Integron catB9 - 718932..819981 101049


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Ribonuclease toxin, BrnT, of type II toxin-antitoxin system

(6-81)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 89 a.a.        Molecular weight: 10092.34 Da        Isoelectric Point: 7.3171

>T254468 WP_000589156.1 NZ_CP102928:743072-743338 [Vibrio cholerae]
MIKFEFDENKSRSNLEKHGIDFHTAQGLWNDSDLIEIPANTSDEPRYLVVGLLNGKHWSGVITYRGTNIRIISVRRSRKA
EVSLYESA

Download         Length: 267 bp

Antitoxin


Download         Length: 82 a.a.        Molecular weight: 9478.77 Da        Isoelectric Point: 6.4832

>AT254468 WP_000643598.1 NZ_CP102928:743325-743570 [Vibrio cholerae]
MKAHEFDAKFESDDDDIVMDLDLSQAKRPMHKQKRVNVDFPAWMLESLDREASRIGVTRQSIIKIWLAERLESVSHHSSV
R

Download         Length: 246 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A271VMP7

Antitoxin

Source ID Structure
AlphaFold DB A0A271VME2

References