Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | relBE/ParE-Phd |
Location | 222332..222879 | Replicon | chromosome |
Accession | NZ_AP024554 | ||
Organism | Vibrio cholerae strain IDH-03329 |
Toxin (Protein)
Gene name | relE | Uniprot ID | Q9KM92 |
Locus tag | K6J80_RS14865 | Protein ID | WP_000229317.1 |
Coordinates | 222332..222634 (-) | Length | 101 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | Q9KM93 |
Locus tag | K6J80_RS14870 | Protein ID | WP_000861987.1 |
Coordinates | 222622..222879 (-) | Length | 86 a.a. |
Genomic Context
Location: 225953..226225 (273 bp)
Type: Others
Protein ID: WP_000246253.1
Type: Others
Protein ID: WP_000246253.1
Location: 226222..226719 (498 bp)
Type: Others
Protein ID: WP_000982260.1
Type: Others
Protein ID: WP_000982260.1
Location: 217531..217599 (69 bp)
Type: Others
Protein ID: Protein_190
Type: Others
Protein ID: Protein_190
Location: 217656..218255 (600 bp)
Type: Others
Protein ID: WP_001891245.1
Type: Others
Protein ID: WP_001891245.1
Location: 218405..219277 (873 bp)
Type: Others
Protein ID: WP_000254716.1
Type: Others
Protein ID: WP_000254716.1
Location: 219452..219673 (222 bp)
Type: Others
Protein ID: Protein_193
Type: Others
Protein ID: Protein_193
Location: 219734..220171 (438 bp)
Type: Others
Protein ID: WP_000503169.1
Type: Others
Protein ID: WP_000503169.1
Location: 220290..220499 (210 bp)
Type: Others
Protein ID: Protein_195
Type: Others
Protein ID: Protein_195
Location: 220635..221024 (390 bp)
Type: Others
Protein ID: WP_001081302.1
Type: Others
Protein ID: WP_001081302.1
Location: 221181..222098 (918 bp)
Type: Others
Protein ID: WP_000186333.1
Type: Others
Protein ID: WP_000186333.1
Location: 222332..222634 (303 bp)
Type: Toxin
Protein ID: WP_000229317.1
Type: Toxin
Protein ID: WP_000229317.1
Location: 222622..222879 (258 bp)
Type: Antitoxin
Protein ID: WP_000861987.1
Type: Antitoxin
Protein ID: WP_000861987.1
Location: 222961..223071 (111 bp)
Type: Others
Protein ID: WP_086010065.1
Type: Others
Protein ID: WP_086010065.1
Location: 223081..223614 (534 bp)
Type: Others
Protein ID: WP_000118351.1
Type: Others
Protein ID: WP_000118351.1
Location: 223611..223880 (270 bp)
Type: Others
Protein ID: WP_000179600.1
Type: Others
Protein ID: WP_000179600.1
Location: 224103..224474 (372 bp)
Type: Others
Protein ID: WP_001164080.1
Type: Others
Protein ID: WP_001164080.1
Location: 224615..224902 (288 bp)
Type: Others
Protein ID: WP_000426470.1
Type: Others
Protein ID: WP_000426470.1
Location: 225054..225722 (669 bp)
Type: Others
Protein ID: WP_000043871.1
Type: Others
Protein ID: WP_000043871.1
Location: 225739..225801 (63 bp)
Type: Others
Protein ID: Protein_206
Type: Others
Protein ID: Protein_206
Location: 226736..226804 (69 bp)
Type: Others
Protein ID: Protein_209
Type: Others
Protein ID: Protein_209
Location: 226921..227025 (105 bp)
Type: Others
Protein ID: WP_228840819.1
Type: Others
Protein ID: WP_228840819.1
Location: 227216..227338 (123 bp)
Type: Others
Protein ID: Protein_211
Type: Others
Protein ID: Protein_211
Location: 227395..227850 (456 bp)
Type: Others
Protein ID: WP_001245327.1
Type: Others
Protein ID: WP_001245327.1
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
K6J80_RS14825 | 217531..217599 | - | 69 | Protein_190 | acetyltransferase | - |
K6J80_RS14830 | 217656..218255 | - | 600 | WP_001891245.1 | glutathione S-transferase N-terminal domain-containing protein | - |
K6J80_RS14835 | 218405..219277 | - | 873 | WP_000254716.1 | DUF3800 domain-containing protein | - |
K6J80_RS14840 | 219452..219673 | - | 222 | Protein_193 | GNAT family N-acetyltransferase | - |
K6J80_RS14845 | 219734..220171 | - | 438 | WP_000503169.1 | IS200/IS605-like element IS1004 family transposase | - |
K6J80_RS14850 | 220290..220499 | - | 210 | Protein_195 | GNAT family N-acetyltransferase | - |
K6J80_RS14855 | 220635..221024 | - | 390 | WP_001081302.1 | hypothetical protein | - |
K6J80_RS14860 | 221181..222098 | - | 918 | WP_000186333.1 | alpha/beta hydrolase | - |
K6J80_RS14865 | 222332..222634 | - | 303 | WP_000229317.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
K6J80_RS14870 | 222622..222879 | - | 258 | WP_000861987.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
K6J80_RS18935 | 222961..223071 | - | 111 | WP_086010065.1 | DUF3265 domain-containing protein | - |
K6J80_RS14875 | 223081..223614 | - | 534 | WP_000118351.1 | GNAT family N-acetyltransferase | - |
K6J80_RS18940 | 223611..223880 | - | 270 | WP_000179600.1 | DUF1778 domain-containing protein | - |
K6J80_RS14885 | 224103..224474 | - | 372 | WP_001164080.1 | MazG nucleotide pyrophosphohydrolase domain-containing protein | - |
K6J80_RS14890 | 224615..224902 | - | 288 | WP_000426470.1 | hypothetical protein | - |
K6J80_RS14895 | 225054..225722 | - | 669 | WP_000043871.1 | hypothetical protein | - |
K6J80_RS18945 | 225739..225801 | - | 63 | Protein_206 | acetyltransferase | - |
K6J80_RS14900 | 225953..226225 | + | 273 | WP_000246253.1 | DUF1778 domain-containing protein | - |
K6J80_RS14905 | 226222..226719 | + | 498 | WP_000982260.1 | GNAT family N-acetyltransferase | - |
K6J80_RS18950 | 226736..226804 | - | 69 | Protein_209 | acetyltransferase | - |
K6J80_RS14910 | 226921..227025 | - | 105 | WP_228840819.1 | DUF645 family protein | - |
K6J80_RS18955 | 227216..227338 | - | 123 | Protein_211 | acetyltransferase | - |
K6J80_RS14915 | 227395..227850 | - | 456 | WP_001245327.1 | GNAT family N-acetyltransferase | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | catB9 | - | 213119..319686 | 106567 | |
inside | Integron | - | - | 213119..312856 | 99737 | ||
flank | IS/Tn | - | - | 219734..220171 | 437 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 101 a.a. Molecular weight: 11726.68 Da Isoelectric Point: 5.1972
>T38670 WP_000229317.1 NZ_AP024554:c222634-222332 [Vibrio cholerae]
MVEIIWTELALSDLNDIAEYIALENVVAAKQLVQTVFTKVERLADFPESGRVPPELEHLNYREVVVSPCRVFYKYDDAKV
RILFVMRAERDLRRLMLTKQ
MVEIIWTELALSDLNDIAEYIALENVVAAKQLVQTVFTKVERLADFPESGRVPPELEHLNYREVVVSPCRVFYKYDDAKV
RILFVMRAERDLRRLMLTKQ
Download Length: 303 bp
>T38670 NZ_AP024554:c222634-222332 [Vibrio cholerae]
ATGGTTGAAATAATTTGGACGGAGCTGGCTCTATCCGACTTGAATGATATTGCTGAATACATCGCGCTTGAAAATGTCGT
GGCTGCTAAACAACTGGTGCAAACCGTTTTTACAAAAGTTGAACGTTTGGCCGATTTTCCAGAGTCTGGGCGCGTCCCTC
CAGAACTAGAACACCTCAATTATCGTGAAGTCGTTGTAAGTCCGTGTCGTGTTTTCTACAAGTATGATGATGCAAAGGTT
CGTATTCTTTTTGTTATGCGTGCGGAGCGAGATTTGCGTCGGTTAATGCTTACGAAACAGTAG
ATGGTTGAAATAATTTGGACGGAGCTGGCTCTATCCGACTTGAATGATATTGCTGAATACATCGCGCTTGAAAATGTCGT
GGCTGCTAAACAACTGGTGCAAACCGTTTTTACAAAAGTTGAACGTTTGGCCGATTTTCCAGAGTCTGGGCGCGTCCCTC
CAGAACTAGAACACCTCAATTATCGTGAAGTCGTTGTAAGTCCGTGTCGTGTTTTCTACAAGTATGATGATGCAAAGGTT
CGTATTCTTTTTGTTATGCGTGCGGAGCGAGATTTGCGTCGGTTAATGCTTACGAAACAGTAG
Antitoxin
Download Length: 86 a.a. Molecular weight: 9647.15 Da Isoelectric Point: 7.3178
>AT38670 WP_000861987.1 NZ_AP024554:c222879-222622 [Vibrio cholerae]
MKVELVTSLKRQATKILADLHDTKEPVLITEHGKPSAYLIDVDDYEFMQNRLAILEGIARGERALADGKVVSHQDAKDRM
SKWLK
MKVELVTSLKRQATKILADLHDTKEPVLITEHGKPSAYLIDVDDYEFMQNRLAILEGIARGERALADGKVVSHQDAKDRM
SKWLK
Download Length: 258 bp
>AT38670 NZ_AP024554:c222879-222622 [Vibrio cholerae]
ATGAAAGTAGAACTTGTGACGTCACTAAAACGTCAGGCCACTAAGATCCTTGCCGATCTTCATGATACGAAAGAGCCAGT
ATTGATAACTGAGCACGGAAAACCGTCAGCTTACCTTATTGATGTAGACGACTATGAATTTATGCAAAATCGTTTAGCGA
TCCTGGAAGGTATTGCTCGCGGAGAGCGAGCTTTAGCGGATGGTAAAGTGGTCAGCCATCAAGATGCTAAGGACAGAATG
TCAAAATGGTTGAAATAA
ATGAAAGTAGAACTTGTGACGTCACTAAAACGTCAGGCCACTAAGATCCTTGCCGATCTTCATGATACGAAAGAGCCAGT
ATTGATAACTGAGCACGGAAAACCGTCAGCTTACCTTATTGATGTAGACGACTATGAATTTATGCAAAATCGTTTAGCGA
TCCTGGAAGGTATTGCTCGCGGAGAGCGAGCTTTAGCGGATGGTAAAGTGGTCAGCCATCAAGATGCTAAGGACAGAATG
TCAAAATGGTTGAAATAA
Structures
Toxin
Loading, please wait
Source | ID | Structure |
---|---|---|
AlphaFold DB | Q9KM92 |
Antitoxin
Loading, please wait
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A1T4SLM9 |