Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | relBE/RelE-RelB |
Location | 346769..347328 | Replicon | chromosome |
Accession | NZ_CP047300 | ||
Organism | Vibrio cholerae O1 biovar El Tor strain P27459 |
Toxin (Protein)
Gene name | relE | Uniprot ID | Q9K2M8 |
Locus tag | GTF71_RS15080 | Protein ID | WP_000578476.1 |
Coordinates | 346769..347047 (-) | Length | 93 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | Q9L991 |
Locus tag | GTF71_RS15085 | Protein ID | WP_000381183.1 |
Coordinates | 347044..347328 (-) | Length | 95 a.a. |
Genomic Context
Location: 341847..342353 (507 bp)
Type: Others
Protein ID: WP_000393074.1
Type: Others
Protein ID: WP_000393074.1
Location: 342510..342896 (387 bp)
Type: Others
Protein ID: WP_000703163.1
Type: Others
Protein ID: WP_000703163.1
Location: 343153..343356 (204 bp)
Type: Others
Protein ID: WP_001911580.1
Type: Others
Protein ID: WP_001911580.1
Location: 343551..343802 (252 bp)
Type: Others
Protein ID: WP_001890111.1
Type: Others
Protein ID: WP_001890111.1
Location: 343775..343924 (150 bp)
Type: Others
Protein ID: WP_071908333.1
Type: Others
Protein ID: WP_071908333.1
Location: 344071..344496 (426 bp)
Type: Others
Protein ID: WP_000415750.1
Type: Others
Protein ID: WP_000415750.1
Location: 344702..345325 (624 bp)
Type: Others
Protein ID: WP_000247070.1
Type: Others
Protein ID: WP_000247070.1
Location: 345538..346017 (480 bp)
Type: Others
Protein ID: WP_000009888.1
Type: Others
Protein ID: WP_000009888.1
Location: 346205..346618 (414 bp)
Type: Others
Protein ID: WP_000049420.1
Type: Others
Protein ID: WP_000049420.1
Location: 347523..348038 (516 bp)
Type: Others
Protein ID: WP_001201520.1
Type: Others
Protein ID: WP_001201520.1
Location: 348103..348699 (597 bp)
Type: Others
Protein ID: WP_000255434.1
Type: Others
Protein ID: WP_000255434.1
Location: 349091..349273 (183 bp)
Type: Others
Protein ID: WP_000923182.1
Type: Others
Protein ID: WP_000923182.1
Location: 349473..349946 (474 bp)
Type: Others
Protein ID: WP_001161076.1
Type: Others
Protein ID: WP_001161076.1
Location: 349943..350053 (111 bp)
Type: Others
Protein ID: WP_071908312.1
Type: Others
Protein ID: WP_071908312.1
Location: 350095..350721 (627 bp)
Type: Others
Protein ID: WP_000365424.1
Type: Others
Protein ID: WP_000365424.1
Location: 350844..351542 (699 bp)
Type: Others
Protein ID: WP_001890502.1
Type: Others
Protein ID: WP_001890502.1
Location: 351546..351662 (117 bp)
Type: Others
Protein ID: WP_071908339.1
Type: Others
Protein ID: WP_071908339.1
Location: 346625..346720 (96 bp)
Type: Others
Protein ID: Protein_325
Type: Others
Protein ID: Protein_325
Location: 346769..347047 (279 bp)
Type: Toxin
Protein ID: WP_000578476.1
Type: Toxin
Protein ID: WP_000578476.1
Location: 347044..347328 (285 bp)
Type: Antitoxin
Protein ID: WP_000381183.1
Type: Antitoxin
Protein ID: WP_000381183.1
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
GTF71_RS15030 | 341847..342353 | + | 507 | WP_000393074.1 | hypothetical protein | - |
GTF71_RS15035 | 342510..342896 | + | 387 | WP_000703163.1 | VOC family protein | - |
GTF71_RS15040 | 343153..343356 | + | 204 | WP_001911580.1 | hypothetical protein | - |
GTF71_RS15045 | 343551..343802 | + | 252 | WP_001890111.1 | TIGR03643 family protein | - |
GTF71_RS15050 | 343775..343924 | + | 150 | WP_071908333.1 | DUF3265 domain-containing protein | - |
GTF71_RS15055 | 344071..344496 | + | 426 | WP_000415750.1 | hypothetical protein | - |
GTF71_RS15060 | 344702..345325 | + | 624 | WP_000247070.1 | DUF1349 domain-containing protein | - |
GTF71_RS15065 | 345538..346017 | + | 480 | WP_000009888.1 | lecithin retinol acyltransferase family protein | - |
GTF71_RS15070 | 346205..346618 | + | 414 | WP_000049420.1 | VOC family protein | - |
GTF71_RS15075 | 346625..346720 | - | 96 | Protein_325 | hypothetical protein | - |
GTF71_RS15080 | 346769..347047 | - | 279 | WP_000578476.1 | type II toxin-antitoxin system mRNA interferase toxin, RelE/StbE family | Toxin |
GTF71_RS15085 | 347044..347328 | - | 285 | WP_000381183.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
GTF71_RS15090 | 347523..348038 | + | 516 | WP_001201520.1 | lipocalin family protein | - |
GTF71_RS15095 | 348103..348699 | + | 597 | WP_000255434.1 | hypothetical protein | - |
GTF71_RS15100 | 349091..349273 | + | 183 | WP_000923182.1 | DUF645 family protein | - |
GTF71_RS15105 | 349473..349946 | + | 474 | WP_001161076.1 | GrpB family protein | - |
GTF71_RS15110 | 349943..350053 | + | 111 | WP_071908312.1 | DUF3265 domain-containing protein | - |
GTF71_RS15115 | 350095..350721 | + | 627 | WP_000365424.1 | LysE family translocator | - |
GTF71_RS15120 | 350844..351542 | + | 699 | WP_001890502.1 | hypothetical protein | - |
GTF71_RS15125 | 351546..351662 | + | 117 | WP_071908339.1 | DUF3265 domain-containing protein | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | catB9 | - | 306926..439292 | 132366 | |
inside | Integron | - | - | 312006..438916 | 126910 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 93 a.a. Molecular weight: 10819.59 Da Isoelectric Point: 5.1651
>T145847 WP_000578476.1 NZ_CP047300:c347047-346769 [Vibrio cholerae O1 biovar El Tor]
MIFWEEASLNDREKIFEFLYDFNPAAAKKTDELIEAKVENLLEQPLIGVQRDGIRGRLLIIPEISMIVSYWVDGSKIRIM
RVLHQKQKFPND
MIFWEEASLNDREKIFEFLYDFNPAAAKKTDELIEAKVENLLEQPLIGVQRDGIRGRLLIIPEISMIVSYWVDGSKIRIM
RVLHQKQKFPND
Download Length: 279 bp
>T145847 NZ_CP062702:c3469016-3468861 [Escherichia coli O157:H7]
ATGAAGCAGCAAAAGGCGATGTTAATCGCCCTGATCGTCATCTGTTTAACCGTCATAGTGACGGCACTGGTAACGAGGAA
AGACCTCTGCGAGGTACGAGTCCGAACCGGCCAGACGGAGGTCGCTGTCTTCACAGCTTACGAACCTGAGGAGTAA
ATGAAGCAGCAAAAGGCGATGTTAATCGCCCTGATCGTCATCTGTTTAACCGTCATAGTGACGGCACTGGTAACGAGGAA
AGACCTCTGCGAGGTACGAGTCCGAACCGGCCAGACGGAGGTCGCTGTCTTCACAGCTTACGAACCTGAGGAGTAA
Antitoxin
Download Length: 95 a.a. Molecular weight: 10901.25 Da Isoelectric Point: 8.0775
>AT145847 WP_000381183.1 NZ_CP047300:c347328-347044 [Vibrio cholerae O1 biovar El Tor]
MDTRIQFRVDEETKRLAQQMAESQGRTLSDACRELTEQLAEQQRKALSHDAWLTEQVNQAFEKFDSGKAVFIEHDIAKAR
MAERKAKIRNRGHA
MDTRIQFRVDEETKRLAQQMAESQGRTLSDACRELTEQLAEQQRKALSHDAWLTEQVNQAFEKFDSGKAVFIEHDIAKAR
MAERKAKIRNRGHA
Download Length: 285 bp
>AT145847 NZ_CP062702:3469028-3469086 [Escherichia coli O157:H7]
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTAGATTTGCCGTTCATAGATTGAGCCTCA
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTAGATTTGCCGTTCATAGATTGAGCCTCA
Structures
Toxin
Loading, please wait
Source | ID | Structure |
---|---|---|
AlphaFold DB | Q9K2M8 |
Antitoxin
Loading, please wait
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A067BL33 |