Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/RelE-MqsA |
Location | 417259..417892 | Replicon | chromosome |
Accession | NZ_CP028828 | ||
Organism | Vibrio cholerae strain N16961 |
Toxin (Protein)
Gene name | higB | Uniprot ID | Q9KMA6 |
Locus tag | N16961_RS16520 | Protein ID | WP_000843587.1 |
Coordinates | 417259..417591 (+) | Length | 111 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | N16961_RS16525 | Protein ID | WP_000071008.1 |
Coordinates | 417578..417892 (+) | Length | 105 a.a. |
Genomic Context
Location: 412700..412903 (204 bp)
Type: Others
Protein ID: WP_001911745.1
Type: Others
Protein ID: WP_001911745.1
Location: 413184..413357 (174 bp)
Type: Others
Protein ID: WP_001882305.1
Type: Others
Protein ID: WP_001882305.1
Location: 413717..413986 (270 bp)
Type: Others
Protein ID: WP_001198131.1
Type: Others
Protein ID: WP_001198131.1
Location: 414304..414475 (172 bp)
Type: Others
Protein ID: Protein_435
Type: Others
Protein ID: Protein_435
Location: 414684..415070 (387 bp)
Type: Others
Protein ID: WP_000703163.1
Type: Others
Protein ID: WP_000703163.1
Location: 415272..415514 (243 bp)
Type: Others
Protein ID: WP_000107461.1
Type: Others
Protein ID: WP_000107461.1
Location: 415685..416062 (378 bp)
Type: Others
Protein ID: WP_000411109.1
Type: Others
Protein ID: WP_000411109.1
Location: 416119..416233 (115 bp)
Type: Others
Protein ID: Protein_439
Type: Others
Protein ID: Protein_439
Location: 416182..416463 (282 bp)
Type: Others
Protein ID: WP_001894453.1
Type: Others
Protein ID: WP_001894453.1
Location: 416629..416742 (114 bp)
Type: Others
Protein ID: WP_001889158.1
Type: Others
Protein ID: WP_001889158.1
Location: 416691..416918 (228 bp)
Type: Others
Protein ID: WP_001894457.1
Type: Others
Protein ID: WP_001894457.1
Location: 417259..417591 (333 bp)
Type: Toxin
Protein ID: WP_000843587.1
Type: Toxin
Protein ID: WP_000843587.1
Location: 417578..417892 (315 bp)
Type: Antitoxin
Protein ID: WP_000071008.1
Type: Antitoxin
Protein ID: WP_000071008.1
Location: 418029..418463 (435 bp)
Type: Others
Protein ID: WP_000256036.1
Type: Others
Protein ID: WP_000256036.1
Location: 418631..418786 (156 bp)
Type: Others
Protein ID: WP_000751734.1
Type: Others
Protein ID: WP_000751734.1
Location: 419959..420265 (307 bp)
Type: Others
Protein ID: Protein_448
Type: Others
Protein ID: Protein_448
Location: 420402..421094 (693 bp)
Type: Others
Protein ID: WP_001047169.1
Type: Others
Protein ID: WP_001047169.1
Location: 421094..421495 (402 bp)
Type: Others
Protein ID: WP_000351248.1
Type: Others
Protein ID: WP_000351248.1
Location: 421465..421608 (144 bp)
Type: Others
Protein ID: WP_071908341.1
Type: Others
Protein ID: WP_071908341.1
Location: 421683..422096 (414 bp)
Type: Others
Protein ID: WP_000049417.1
Type: Others
Protein ID: WP_000049417.1
Location: 422310..422561 (252 bp)
Type: Others
Protein ID: WP_001250179.1
Type: Others
Protein ID: WP_001250179.1
Location: 422551..422838 (288 bp)
Type: Others
Protein ID: WP_000221354.1
Type: Others
Protein ID: WP_000221354.1
Location: 418911..419891 (981 bp)
Type: Others
Protein ID: WP_000019370.1
Type: Others
Protein ID: WP_000019370.1
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N16961_RS19765 | 412700..412903 | + | 204 | WP_001911745.1 | hypothetical protein | - |
N16961_RS16450 | 413184..413357 | + | 174 | WP_001882305.1 | DUF3709 domain-containing protein | - |
N16961_RS16455 | 413717..413986 | + | 270 | WP_001198131.1 | hypothetical protein | - |
N16961_RS19940 | 414304..414475 | + | 172 | Protein_435 | DUF645 family protein | - |
N16961_RS16470 | 414684..415070 | + | 387 | WP_000703163.1 | VOC family protein | - |
N16961_RS16475 | 415272..415514 | + | 243 | WP_000107461.1 | hypothetical protein | - |
N16961_RS16480 | 415685..416062 | + | 378 | WP_000411109.1 | hypothetical protein | - |
N16961_RS19945 | 416119..416233 | + | 115 | Protein_439 | acetyltransferase | - |
N16961_RS16485 | 416182..416463 | + | 282 | WP_001894453.1 | DUF1289 domain-containing protein | - |
N16961_RS16500 | 416629..416742 | + | 114 | WP_001889158.1 | hypothetical protein | - |
N16961_RS16505 | 416691..416918 | + | 228 | WP_001894457.1 | DUF1289 domain-containing protein | - |
N16961_RS16520 | 417259..417591 | + | 333 | WP_000843587.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
N16961_RS16525 | 417578..417892 | + | 315 | WP_000071008.1 | DNA-binding transcriptional regulator | Antitoxin |
N16961_RS16530 | 418029..418463 | + | 435 | WP_000256036.1 | GNAT family N-acetyltransferase | - |
N16961_RS19670 | 418631..418786 | + | 156 | WP_000751734.1 | hypothetical protein | - |
N16961_RS16535 | 418911..419891 | - | 981 | WP_000019370.1 | IS5-like element ISVch5 family transposase | - |
N16961_RS16540 | 419959..420265 | + | 307 | Protein_448 | CatB-related O-acetyltransferase | - |
N16961_RS16545 | 420402..421094 | + | 693 | WP_001047169.1 | GNAT family N-acetyltransferase | - |
N16961_RS16550 | 421094..421495 | + | 402 | WP_000351248.1 | type II toxin-antitoxin system death-on-curing family toxin | - |
N16961_RS16555 | 421465..421608 | + | 144 | WP_071908341.1 | DUF3265 domain-containing protein | - |
N16961_RS16560 | 421683..422096 | + | 414 | WP_000049417.1 | VOC family protein | - |
N16961_RS16565 | 422310..422561 | + | 252 | WP_001250179.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | - |
N16961_RS16570 | 422551..422838 | + | 288 | WP_000221354.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | catB9 | - | 306977..438073 | 131096 | |
inside | Integron | - | - | 312057..437697 | 125640 | ||
flank | IS/Tn | - | - | 418911..419891 | 980 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 111 a.a. Molecular weight: 13005.95 Da Isoelectric Point: 9.9244
>T104256 WP_000843587.1 NZ_CP028828:417259-417591 [Vibrio cholerae]
MKSVFVESTIFEKYRDEYLSDEEYRLFQAELMLNPKLGDVIQGTGGLRKIRVASKGKGKRGGSRIIYYFLDEKRRFYLLT
IYGKNEMSDLNANQRKQLMAFMEAWRNEQS
MKSVFVESTIFEKYRDEYLSDEEYRLFQAELMLNPKLGDVIQGTGGLRKIRVASKGKGKRGGSRIIYYFLDEKRRFYLLT
IYGKNEMSDLNANQRKQLMAFMEAWRNEQS
Download Length: 333 bp
>T104256 NZ_CP028828:417259-417591 [Vibrio cholerae]
ATGAAAAGTGTATTTGTCGAATCAACAATTTTTGAAAAGTACCGAGATGAATATCTCAGTGATGAGGAGTATAGGCTCTT
TCAAGCAGAGCTAATGCTAAACCCCAAGCTGGGTGATGTGATTCAAGGTACTGGCGGTTTGCGAAAAATTCGAGTTGCGA
GTAAAGGCAAGGGAAAGCGTGGTGGTTCACGGATTATCTATTACTTTCTCGATGAAAAGAGGCGTTTCTATTTGCTAACC
ATTTACGGCAAAAATGAAATGTCTGACTTGAATGCAAATCAAAGGAAACAACTAATGGCTTTTATGGAGGCGTGGCGCAA
TGAGCAATCGTGA
ATGAAAAGTGTATTTGTCGAATCAACAATTTTTGAAAAGTACCGAGATGAATATCTCAGTGATGAGGAGTATAGGCTCTT
TCAAGCAGAGCTAATGCTAAACCCCAAGCTGGGTGATGTGATTCAAGGTACTGGCGGTTTGCGAAAAATTCGAGTTGCGA
GTAAAGGCAAGGGAAAGCGTGGTGGTTCACGGATTATCTATTACTTTCTCGATGAAAAGAGGCGTTTCTATTTGCTAACC
ATTTACGGCAAAAATGAAATGTCTGACTTGAATGCAAATCAAAGGAAACAACTAATGGCTTTTATGGAGGCGTGGCGCAA
TGAGCAATCGTGA
Antitoxin
Download Length: 105 a.a. Molecular weight: 11696.20 Da Isoelectric Point: 6.7600
>AT104256 WP_000071008.1 NZ_CP028828:417578-417892 [Vibrio cholerae]
MSNRDLFAELSSALVEAKQHSEGKLTLKTHHVNDVGELNISPDEIVSIREQFNMSRGVFARLLHTSSRTLENWEQGRSVP
NGQAVTLLKLVQRHPETLSHIAEL
MSNRDLFAELSSALVEAKQHSEGKLTLKTHHVNDVGELNISPDEIVSIREQFNMSRGVFARLLHTSSRTLENWEQGRSVP
NGQAVTLLKLVQRHPETLSHIAEL
Download Length: 315 bp
>AT104256 NZ_CP028828:417578-417892 [Vibrio cholerae]
ATGAGCAATCGTGATTTATTTGCAGAGTTAAGCTCAGCTCTTGTTGAGGCTAAGCAGCATTCAGAAGGTAAGCTTACTCT
GAAAACACATCATGTGAATGATGTGGGTGAGTTGAACATCTCACCGGATGAAATCGTGAGTATTCGCGAGCAGTTCAATA
TGTCCCGCGGAGTCTTCGCGCGGTTACTTCATACGTCTTCGCGCACATTAGAAAACTGGGAACAAGGTCGTAGTGTGCCA
AATGGTCAAGCGGTCACTCTTTTAAAGTTAGTACAGCGTCATCCAGAAACGTTGTCACACATAGCCGAGCTATAA
ATGAGCAATCGTGATTTATTTGCAGAGTTAAGCTCAGCTCTTGTTGAGGCTAAGCAGCATTCAGAAGGTAAGCTTACTCT
GAAAACACATCATGTGAATGATGTGGGTGAGTTGAACATCTCACCGGATGAAATCGTGAGTATTCGCGAGCAGTTCAATA
TGTCCCGCGGAGTCTTCGCGCGGTTACTTCATACGTCTTCGCGCACATTAGAAAACTGGGAACAAGGTCGTAGTGTGCCA
AATGGTCAAGCGGTCACTCTTTTAAAGTTAGTACAGCGTCATCCAGAAACGTTGTCACACATAGCCGAGCTATAA