295397

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/ParE-YafN
Location 440647..441175 Replicon chromosome
Accession NZ_OW443148
Organism Vibrio cholerae strain CNRVC190243 isolate YE-NCPHL-19014-PI

Toxin (Protein)


Gene name relE Uniprot ID A0A0X1KZS6
Locus tag OC617_RS16235 Protein ID WP_000221354.1
Coordinates 440888..441175 (+) Length 96 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID A0A0X1KZS8
Locus tag OC617_RS16230 Protein ID WP_001250179.1
Coordinates 440647..440898 (+) Length 84 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OC617_RS16180 (CNRVC190243H_03173) 435915..436229 + 315 WP_000071008.1 DNA-binding transcriptional regulator -
OC617_RS16185 (CNRVC190243H_03174) 436366..436800 + 435 WP_000256036.1 GNAT family N-acetyltransferase -
OC617_RS16190 (CNRVC190243H_03175) 436968..437123 + 156 WP_000751734.1 hypothetical protein -
OC617_RS16195 (CNRVC190243H_03176) 437248..438228 - 981 WP_000019370.1 IS5-like element ISVch5 family transposase -
OC617_RS16200 (CNRVC190243H_03177) 438296..438602 + 307 Protein_462 CatB-related O-acetyltransferase -
OC617_RS16205 438739..439137 + 399 Protein_463 GNAT family N-acetyltransferase -
OC617_RS16210 439261..439431 + 171 WP_001080654.1 hypothetical protein -
OC617_RS16215 (CNRVC190243H_03179) 439431..439832 + 402 WP_000351248.1 type II toxin-antitoxin system death-on-curing family toxin -
OC617_RS16220 439835..439945 + 111 WP_082798255.1 DUF3265 domain-containing protein -
OC617_RS16225 (CNRVC190243H_03180) 440020..440433 + 414 WP_000049417.1 VOC family protein -
OC617_RS16230 (CNRVC190243H_03181) 440647..440898 + 252 WP_001250179.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
OC617_RS16235 (CNRVC190243H_03182) 440888..441175 + 288 WP_000221354.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
OC617_RS16240 (CNRVC190243H_03183) 441303..441758 + 456 WP_001245327.1 GNAT family N-acetyltransferase -
OC617_RS16245 441815..441937 + 123 Protein_471 acetyltransferase -
OC617_RS16250 442108..442232 + 125 Protein_472 DUF645 family protein -
OC617_RS16255 442349..442417 + 69 Protein_473 acetyltransferase -
OC617_RS16260 (CNRVC190243H_03184) 442434..442931 - 498 WP_000982260.1 GNAT family N-acetyltransferase -
OC617_RS16265 (CNRVC190243H_03185) 442928..443200 - 273 WP_000246253.1 DUF1778 domain-containing protein -
OC617_RS16270 443352..443414 + 63 Protein_476 acetyltransferase -
OC617_RS16275 (CNRVC190243H_03186) 443431..444099 + 669 WP_000043871.1 hypothetical protein -
OC617_RS16280 (CNRVC190243H_03187) 444251..444538 + 288 WP_000426470.1 hypothetical protein -
OC617_RS16285 (CNRVC190243H_03188) 444679..445050 + 372 WP_001164080.1 MazG nucleotide pyrophosphohydrolase domain-containing protein -
OC617_RS16290 (CNRVC190243H_03189) 445273..445542 + 270 WP_000179600.1 DUF1778 domain-containing protein -
OC617_RS16295 (CNRVC190243H_03190) 445539..446072 + 534 WP_000118351.1 GNAT family N-acetyltransferase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Genomic island catB9 - 349905..456410 106505
inside Integron catB9 - 354985..456034 101049
flank IS/Tn - - 437248..438228 980


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(5-84)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(11-71)


Sequences

Toxin        


Download         Length: 96 a.a.        Molecular weight: 10991.96 Da        Isoelectric Point: 10.4934

>T295397 WP_000221354.1 NZ_OW443148:440888-441175 [Vibrio cholerae]
MTYKLKFLPAAQKEWSKLAPTIQSQFKKKLKERLENPHVPSAKLRGYDAVYKIKLRTAGYRLAYEVIDDEIVVYVLAVGK
RDKDAVYKKLASRFG

Download         Length: 288 bp

Antitoxin


Download         Length: 84 a.a.        Molecular weight: 9136.29 Da        Isoelectric Point: 4.0197

>AT295397 WP_001250179.1 NZ_OW443148:440647-440898 [Vibrio cholerae]
MRQVLANCSASISELKKNPTALLNEADGSAIAILNHNKPAAYLVPAETYEYLIDMLDDYELSQIVDSRRADLAQAVEVNI
DDL

Download         Length: 252 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0X1KZS6

Antitoxin

Source ID Structure
AlphaFold DB A0A0X1KZS8

References