Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/RelE-RelB |
| Location | 343239..343798 | Replicon | chromosome |
| Accession | NZ_LT906615 | ||
| Organism | Vibrio cholerae O1 biovar El Tor str. N16961 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | Q9K2M8 |
| Locus tag | FY484_RS15595 | Protein ID | WP_000578476.1 |
| Coordinates | 343239..343517 (-) | Length | 93 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | Q9L991 |
| Locus tag | FY484_RS15600 | Protein ID | WP_000381183.1 |
| Coordinates | 343514..343798 (-) | Length | 95 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| FY484_RS15540 | 338317..338823 | + | 507 | WP_000393074.1 | hypothetical protein | - |
| FY484_RS15545 | 338980..339366 | + | 387 | WP_000703163.1 | VOC family protein | - |
| FY484_RS15550 | 339623..339826 | + | 204 | WP_001911580.1 | hypothetical protein | - |
| FY484_RS15555 | 340021..340272 | + | 252 | WP_001890111.1 | TIGR03643 family protein | - |
| FY484_RS15560 | 340245..340394 | + | 150 | WP_071908333.1 | DUF3265 domain-containing protein | - |
| FY484_RS15565 | 340541..340966 | + | 426 | WP_000415750.1 | hypothetical protein | - |
| FY484_RS15570 | 341172..341795 | + | 624 | WP_000247070.1 | DUF1349 domain-containing protein | - |
| FY484_RS15575 | 342008..342487 | + | 480 | WP_000009888.1 | lecithin retinol acyltransferase family protein | - |
| FY484_RS15585 | 342675..343088 | + | 414 | WP_000049420.1 | VOC family protein | - |
| FY484_RS15595 | 343239..343517 | - | 279 | WP_000578476.1 | type II toxin-antitoxin system mRNA interferase toxin, RelE/StbE family | Toxin |
| FY484_RS15600 | 343514..343798 | - | 285 | WP_000381183.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
| FY484_RS15605 | 343993..344508 | + | 516 | WP_001201520.1 | lipocalin family protein | - |
| FY484_RS15610 | 344573..345169 | + | 597 | WP_000255434.1 | hypothetical protein | - |
| FY484_RS15620 | 345561..345743 | + | 183 | WP_000923182.1 | DUF645 family protein | - |
| FY484_RS15625 | 345943..346416 | + | 474 | WP_001161076.1 | GrpB family protein | - |
| FY484_RS15630 | 346431..346523 | + | 93 | WP_014378730.1 | DUF3265 domain-containing protein | - |
| FY484_RS15635 | 346565..347191 | + | 627 | WP_000365424.1 | LysE family translocator | - |
| FY484_RS15640 | 347314..348012 | + | 699 | WP_001890502.1 | hypothetical protein | - |
| FY484_RS15645 | 348022..348132 | + | 111 | WP_079857360.1 | DUF3265 domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | catB9 | - | 304666..435761 | 131095 | |
| inside | Integron | catB9 | - | 309746..435385 | 125639 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 93 a.a. Molecular weight: 10819.59 Da Isoelectric Point: 5.1651
>T293796 WP_000578476.1 NZ_LT906615:c343517-343239 [Vibrio cholerae O1 biovar El Tor str. N16961]
MIFWEEASLNDREKIFEFLYDFNPAAAKKTDELIEAKVENLLEQPLIGVQRDGIRGRLLIIPEISMIVSYWVDGSKIRIM
RVLHQKQKFPND
MIFWEEASLNDREKIFEFLYDFNPAAAKKTDELIEAKVENLLEQPLIGVQRDGIRGRLLIIPEISMIVSYWVDGSKIRIM
RVLHQKQKFPND
Download Length: 279 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | Q9K2M8 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A067BL33 |