293796

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/RelE-RelB
Location 343239..343798 Replicon chromosome
Accession NZ_LT906615
Organism Vibrio cholerae O1 biovar El Tor str. N16961

Toxin (Protein)


Gene name relE Uniprot ID Q9K2M8
Locus tag FY484_RS15595 Protein ID WP_000578476.1
Coordinates 343239..343517 (-) Length 93 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID Q9L991
Locus tag FY484_RS15600 Protein ID WP_000381183.1
Coordinates 343514..343798 (-) Length 95 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
FY484_RS15540 338317..338823 + 507 WP_000393074.1 hypothetical protein -
FY484_RS15545 338980..339366 + 387 WP_000703163.1 VOC family protein -
FY484_RS15550 339623..339826 + 204 WP_001911580.1 hypothetical protein -
FY484_RS15555 340021..340272 + 252 WP_001890111.1 TIGR03643 family protein -
FY484_RS15560 340245..340394 + 150 WP_071908333.1 DUF3265 domain-containing protein -
FY484_RS15565 340541..340966 + 426 WP_000415750.1 hypothetical protein -
FY484_RS15570 341172..341795 + 624 WP_000247070.1 DUF1349 domain-containing protein -
FY484_RS15575 342008..342487 + 480 WP_000009888.1 lecithin retinol acyltransferase family protein -
FY484_RS15585 342675..343088 + 414 WP_000049420.1 VOC family protein -
FY484_RS15595 343239..343517 - 279 WP_000578476.1 type II toxin-antitoxin system mRNA interferase toxin, RelE/StbE family Toxin
FY484_RS15600 343514..343798 - 285 WP_000381183.1 type II toxin-antitoxin system RelB/DinJ family antitoxin Antitoxin
FY484_RS15605 343993..344508 + 516 WP_001201520.1 lipocalin family protein -
FY484_RS15610 344573..345169 + 597 WP_000255434.1 hypothetical protein -
FY484_RS15620 345561..345743 + 183 WP_000923182.1 DUF645 family protein -
FY484_RS15625 345943..346416 + 474 WP_001161076.1 GrpB family protein -
FY484_RS15630 346431..346523 + 93 WP_014378730.1 DUF3265 domain-containing protein -
FY484_RS15635 346565..347191 + 627 WP_000365424.1 LysE family translocator -
FY484_RS15640 347314..348012 + 699 WP_001890502.1 hypothetical protein -
FY484_RS15645 348022..348132 + 111 WP_079857360.1 DUF3265 domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Genomic island catB9 - 304666..435761 131095
inside Integron catB9 - 309746..435385 125639


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(2-89)

Antitoxin

RelB antitoxin/Antitoxin DinJ

(5-70)


Sequences

Toxin        


Download         Length: 93 a.a.        Molecular weight: 10819.59 Da        Isoelectric Point: 5.1651

>T293796 WP_000578476.1 NZ_LT906615:c343517-343239 [Vibrio cholerae O1 biovar El Tor str. N16961]
MIFWEEASLNDREKIFEFLYDFNPAAAKKTDELIEAKVENLLEQPLIGVQRDGIRGRLLIIPEISMIVSYWVDGSKIRIM
RVLHQKQKFPND

Download         Length: 279 bp

Antitoxin


Download         Length: 95 a.a.        Molecular weight: 10901.25 Da        Isoelectric Point: 8.0775

>AT293796 WP_000381183.1 NZ_LT906615:c343798-343514 [Vibrio cholerae O1 biovar El Tor str. N16961]
MDTRIQFRVDEETKRLAQQMAESQGRTLSDACRELTEQLAEQQRKALSHDAWLTEQVNQAFEKFDSGKAVFIEHDIAKAR
MAERKAKIRNRGHA

Download         Length: 285 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB Q9K2M8

Antitoxin

Source ID Structure
AlphaFold DB A0A067BL33

References