Detailed information of TA system    

insolicoBioinformatically predicted

Overview


TA module


Type II Classification (family/domain) relBE/RelE-RelB
Location 752362..752921 Replicon chromosome
Accession NZ_CP102928
Organism Vibrio cholerae strain N1252

Toxin (Protein)


Gene name relE Uniprot ID Q9K2M8
Locus tag NW313_RS17340 Protein ID WP_000578476.1
Coordinates 752362..752640 (-) Length 93 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID Q9L991
Locus tag NW313_RS17345 Protein ID WP_000381183.1
Coordinates 752637..752921 (-) Length 95 a.a.

Genomic Context


Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NW313_RS17290 747440..747946 + 507 WP_000393074.1 hypothetical protein -
NW313_RS17295 748103..748489 + 387 WP_000703163.1 VOC family protein -
NW313_RS17300 748746..748949 + 204 WP_001911580.1 hypothetical protein -
NW313_RS17305 749144..749395 + 252 WP_001890111.1 TIGR03643 family protein -
NW313_RS17310 749368..749517 + 150 WP_071908333.1 DUF3265 domain-containing protein -
NW313_RS17315 749664..750089 + 426 WP_000415750.1 hypothetical protein -
NW313_RS17320 750295..750918 + 624 WP_000247070.1 DUF1349 domain-containing protein -
NW313_RS17325 751131..751610 + 480 WP_000009888.1 lecithin retinol acyltransferase family protein -
NW313_RS17330 751607..751723 + 117 WP_086010882.1 DUF3265 domain-containing protein -
NW313_RS17335 751798..752211 + 414 WP_000049420.1 VOC family protein -
NW313_RS17340 752362..752640 - 279 WP_000578476.1 type II toxin-antitoxin system mRNA interferase toxin, RelE/StbE family Toxin
NW313_RS17345 752637..752921 - 285 WP_000381183.1 type II toxin-antitoxin system RelB/DinJ family antitoxin Antitoxin
NW313_RS17350 753170..753631 + 462 WP_001911578.1 lipocalin family protein -
NW313_RS17355 753696..754292 + 597 WP_000255434.1 hypothetical protein -
NW313_RS17360 754486..754623 + 138 WP_001890145.1 hypothetical protein -
NW313_RS17365 754684..754866 + 183 WP_000923182.1 DUF645 family protein -
NW313_RS17370 755066..755539 + 474 WP_001161076.1 GrpB family protein -
NW313_RS17375 755554..755646 + 93 WP_014378730.1 DUF3265 domain-containing protein -
NW313_RS17380 755688..756314 + 627 WP_000365424.1 LysE family translocator -
NW313_RS17385 756437..757135 + 699 WP_001890502.1 hypothetical protein -
NW313_RS17390 757166..757255 + 90 WP_072606010.1 DUF3265 domain-containing protein -

Associated MGEs


MGE
detail
Similar
MGEs
Relative
position
MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Genomic island catB9 - 713852..820357 106505
inside Integron catB9 - 718932..819981 101049


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.



Sequences


Toxin        


Download         Length: 93 a.a.        Molecular weight: 10819.59 Da        Isoelectric Point: 5.1651

>T254469 WP_000578476.1 NZ_CP102928:c752640-752362 [Vibrio cholerae]
MIFWEEASLNDREKIFEFLYDFNPAAAKKTDELIEAKVENLLEQPLIGVQRDGIRGRLLIIPEISMIVSYWVDGSKIRIM
RVLHQKQKFPND

Download         Length: 279 bp


Antitoxin


Download         Length: 95 a.a.        Molecular weight: 10901.25 Da        Isoelectric Point: 8.0775

>AT254469 WP_000381183.1 NZ_CP102928:c752921-752637 [Vibrio cholerae]
MDTRIQFRVDEETKRLAQQMAESQGRTLSDACRELTEQLAEQQRKALSHDAWLTEQVNQAFEKFDSGKAVFIEHDIAKAR
MAERKAKIRNRGHA

Download         Length: 285 bp


Similar Proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures


Toxin

Source ID Structure
AlphaFold DB Q9K2M8


Antitoxin

Source ID Structure
AlphaFold DB A0A067BL33

References