Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | parDE/ParE-Phd |
Location | 356253..356831 | Replicon | chromosome |
Accession | NZ_CP013306 | ||
Organism | Vibrio cholerae strain CRC1106 |
Toxin (Protein)
Gene name | parE | Uniprot ID | O68848 |
Locus tag | ASZ81_RS16025 | Protein ID | WP_001180243.1 |
Coordinates | 356253..356570 (-) | Length | 106 a.a. |
Antitoxin (Protein)
Gene name | parD | Uniprot ID | Q7DCR7 |
Locus tag | ASZ81_RS16030 | Protein ID | WP_000557292.1 |
Coordinates | 356589..356831 (-) | Length | 81 a.a. |
Genomic Context
Location: 351777..351959 (183 bp)
Type: Others
Protein ID: WP_000923340.1
Type: Others
Protein ID: WP_000923340.1
Location: 352313..352495 (183 bp)
Type: Others
Protein ID: WP_000923153.1
Type: Others
Protein ID: WP_000923153.1
Location: 352690..353367 (678 bp)
Type: Others
Protein ID: WP_000254617.1
Type: Others
Protein ID: WP_000254617.1
Location: 353529..354737 (1209 bp)
Type: Others
Protein ID: WP_000272282.1
Type: Others
Protein ID: WP_000272282.1
Location: 354899..355603 (705 bp)
Type: Others
Protein ID: WP_000087610.1
Type: Others
Protein ID: WP_000087610.1
Location: 355761..356099 (339 bp)
Type: Others
Protein ID: WP_000713853.1
Type: Others
Protein ID: WP_000713853.1
Location: 357075..357461 (387 bp)
Type: Others
Protein ID: WP_001015867.1
Type: Others
Protein ID: WP_001015867.1
Location: 357518..357631 (114 bp)
Type: Others
Protein ID: WP_001900214.1
Type: Others
Protein ID: WP_001900214.1
Location: 357580..357861 (282 bp)
Type: Others
Protein ID: WP_001894429.1
Type: Others
Protein ID: WP_001894429.1
Location: 358119..358655 (537 bp)
Type: Others
Protein ID: WP_000469482.1
Type: Others
Protein ID: WP_000469482.1
Location: 358792..359307 (516 bp)
Type: Others
Protein ID: WP_001201509.1
Type: Others
Protein ID: WP_001201509.1
Location: 360616..360741 (126 bp)
Type: Others
Protein ID: WP_001900195.1
Type: Others
Protein ID: WP_001900195.1
Location: 360757..360795 (39 bp)
Type: Others
Protein ID: WP_106019118.1
Type: Others
Protein ID: WP_106019118.1
Location: 360991..361437 (447 bp)
Type: Others
Protein ID: WP_000006157.1
Type: Others
Protein ID: WP_000006157.1
Location: 356253..356570 (318 bp)
Type: Toxin
Protein ID: WP_001180243.1
Type: Toxin
Protein ID: WP_001180243.1
Location: 356589..356831 (243 bp)
Type: Antitoxin
Protein ID: WP_000557292.1
Type: Antitoxin
Protein ID: WP_000557292.1
Location: 359457..359954 (498 bp)
Type: Others
Protein ID: WP_000982260.1
Type: Others
Protein ID: WP_000982260.1
Location: 359951..360223 (273 bp)
Type: Others
Protein ID: WP_000246254.1
Type: Others
Protein ID: WP_000246254.1
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
ASZ81_RS15995 | 351777..351959 | + | 183 | WP_000923340.1 | DUF645 family protein | - |
ASZ81_RS16000 | 352313..352495 | + | 183 | WP_000923153.1 | DUF645 family protein | - |
ASZ81_RS16005 | 352690..353367 | + | 678 | WP_000254617.1 | HNH endonuclease | - |
ASZ81_RS16010 | 353529..354737 | + | 1209 | WP_000272282.1 | deoxyguanosinetriphosphate triphosphohydrolase family protein | - |
ASZ81_RS16015 | 354899..355603 | + | 705 | WP_000087610.1 | HNH endonuclease | - |
ASZ81_RS16020 | 355761..356099 | + | 339 | WP_000713853.1 | hypothetical protein | - |
ASZ81_RS16025 | 356253..356570 | - | 318 | WP_001180243.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
ASZ81_RS16030 | 356589..356831 | - | 243 | WP_000557292.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
ASZ81_RS16035 | 357075..357461 | + | 387 | WP_001015867.1 | NUDIX hydrolase | - |
ASZ81_RS16040 | 357518..357631 | + | 114 | WP_001900214.1 | hypothetical protein | - |
ASZ81_RS16045 | 357580..357861 | + | 282 | WP_001894429.1 | DUF1289 domain-containing protein | - |
ASZ81_RS16055 | 358119..358655 | + | 537 | WP_000469482.1 | GNAT family N-acetyltransferase | - |
ASZ81_RS16060 | 358792..359307 | + | 516 | WP_001201509.1 | lipocalin family protein | - |
ASZ81_RS16065 | 359457..359954 | - | 498 | WP_000982260.1 | GNAT family N-acetyltransferase | - |
ASZ81_RS16070 | 359951..360223 | - | 273 | WP_000246254.1 | DUF1778 domain-containing protein | - |
ASZ81_RS20490 | 360616..360741 | + | 126 | WP_001900195.1 | DUF645 family protein | - |
ASZ81_RS20495 | 360757..360795 | + | 39 | WP_106019118.1 | hypothetical protein | - |
ASZ81_RS16080 | 360991..361437 | + | 447 | WP_000006157.1 | hypothetical protein | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | catB9 | - | 304741..463550 | 158809 | |
inside | Integron | - | - | 309821..463174 | 153353 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 106 a.a. Molecular weight: 12158.97 Da Isoelectric Point: 9.7495
>T58263 WP_001180243.1 NZ_CP013306:c356570-356253 [Vibrio cholerae]
MQNKQYKLSQLAQEHLLKIKHYTIENFAEAQWQKYKSTLLSGFQTLADNPGLGKSCEDIYQNGFYFPVGKHMAYYTKEAN
FILIVAVLGQSQLPQKHLKQSRFVS
MQNKQYKLSQLAQEHLLKIKHYTIENFAEAQWQKYKSTLLSGFQTLADNPGLGKSCEDIYQNGFYFPVGKHMAYYTKEAN
FILIVAVLGQSQLPQKHLKQSRFVS
Download Length: 318 bp
>T58263 NZ_CP013306:c356570-356253 [Vibrio cholerae]
ATGCAAAATAAACAATATAAGCTCAGCCAATTAGCCCAAGAGCACTTACTCAAGATTAAACACTACACCATTGAAAATTT
CGCTGAAGCGCAGTGGCAAAAATATAAGTCGACCTTGCTTTCAGGTTTCCAAACTCTTGCGGATAACCCAGGACTAGGAA
AAAGCTGTGAAGATATTTACCAAAATGGTTTTTACTTTCCAGTGGGGAAACACATGGCTTATTACACCAAAGAAGCAAAC
TTCATTCTCATTGTTGCGGTATTAGGGCAATCACAACTGCCCCAAAAGCATCTCAAACAGTCACGCTTTGTTTCTTAG
ATGCAAAATAAACAATATAAGCTCAGCCAATTAGCCCAAGAGCACTTACTCAAGATTAAACACTACACCATTGAAAATTT
CGCTGAAGCGCAGTGGCAAAAATATAAGTCGACCTTGCTTTCAGGTTTCCAAACTCTTGCGGATAACCCAGGACTAGGAA
AAAGCTGTGAAGATATTTACCAAAATGGTTTTTACTTTCCAGTGGGGAAACACATGGCTTATTACACCAAAGAAGCAAAC
TTCATTCTCATTGTTGCGGTATTAGGGCAATCACAACTGCCCCAAAAGCATCTCAAACAGTCACGCTTTGTTTCTTAG
Antitoxin
Download Length: 81 a.a. Molecular weight: 8961.25 Da Isoelectric Point: 5.6630
>AT58263 WP_000557292.1 NZ_CP013306:c356831-356589 [Vibrio cholerae]
MHTLTANDAKRNFGELLLSAQREPVIISKNSKNTVVVMSIKDFEELEAMKLDYLKHCFESAQKDLDSGKTVDGATFLNTL
MHTLTANDAKRNFGELLLSAQREPVIISKNSKNTVVVMSIKDFEELEAMKLDYLKHCFESAQKDLDSGKTVDGATFLNTL
Download Length: 243 bp
>AT58263 NZ_CP013306:c356831-356589 [Vibrio cholerae]
ATGCACACACTAACAGCAAATGATGCTAAACGAAATTTTGGTGAACTTCTTCTAAGCGCACAACGCGAACCTGTCATCAT
CAGCAAAAACAGTAAGAATACTGTCGTTGTCATGTCCATTAAGGACTTTGAAGAACTTGAAGCAATGAAACTCGATTATC
TCAAACACTGCTTTGAGTCTGCTCAGAAAGACTTAGATAGTGGCAAAACCGTTGATGGTGCCACTTTTCTAAACACCCTT
TGA
ATGCACACACTAACAGCAAATGATGCTAAACGAAATTTTGGTGAACTTCTTCTAAGCGCACAACGCGAACCTGTCATCAT
CAGCAAAAACAGTAAGAATACTGTCGTTGTCATGTCCATTAAGGACTTTGAAGAACTTGAAGCAATGAAACTCGATTATC
TCAAACACTGCTTTGAGTCTGCTCAGAAAGACTTAGATAGTGGCAAAACCGTTGATGGTGCCACTTTTCTAAACACCCTT
TGA
Structures
Toxin
Loading, please wait
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0K9UJR8 |
Antitoxin
Loading, please wait
Source | ID | Structure |
---|---|---|
AlphaFold DB | Q7DCR7 |