Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | /BrnT(toxin) |
Location | 60257..60755 | Replicon | chromosome |
Accession | NZ_CP007635 | ||
Organism | Vibrio cholerae strain 2012EL-2176 |
Toxin (Protein)
Gene name | - | Uniprot ID | Q9KMK7 |
Locus tag | EN18_RS14485 | Protein ID | WP_000589156.1 |
Coordinates | 60257..60523 (+) | Length | 89 a.a. |
Antitoxin (Protein)
Gene name | - | Uniprot ID | Q9KMK6 |
Locus tag | EN18_RS14490 | Protein ID | WP_000643598.1 |
Coordinates | 60510..60755 (+) | Length | 82 a.a. |
Genomic Context
Location: 55678..55884 (207 bp)
Type: Others
Protein ID: Protein_69
Type: Others
Protein ID: Protein_69
Location: 56084..56185 (102 bp)
Type: Others
Protein ID: WP_001921603.1
Type: Others
Protein ID: WP_001921603.1
Location: 56175..56561 (387 bp)
Type: Others
Protein ID: WP_000703163.1
Type: Others
Protein ID: WP_000703163.1
Location: 56756..57007 (252 bp)
Type: Others
Protein ID: WP_001890111.1
Type: Others
Protein ID: WP_001890111.1
Location: 56980..57129 (150 bp)
Type: Others
Protein ID: WP_071908333.1
Type: Others
Protein ID: WP_071908333.1
Location: 57221..57463 (243 bp)
Type: Others
Protein ID: WP_000107461.1
Type: Others
Protein ID: WP_000107461.1
Location: 57715..57993 (279 bp)
Type: Others
Protein ID: WP_000280324.1
Type: Others
Protein ID: WP_000280324.1
Location: 58368..58511 (144 bp)
Type: Others
Protein ID: Protein_76
Type: Others
Protein ID: Protein_76
Location: 58565..58603 (39 bp)
Type: Others
Protein ID: WP_082798268.1
Type: Others
Protein ID: WP_082798268.1
Location: 58815..59282 (468 bp)
Type: Others
Protein ID: WP_001289288.1
Type: Others
Protein ID: WP_001289288.1
Location: 59410..60072 (663 bp)
Type: Others
Protein ID: WP_000960654.1
Type: Others
Protein ID: WP_000960654.1
Location: 60257..60523 (267 bp)
Type: Toxin
Protein ID: WP_000589156.1
Type: Toxin
Protein ID: WP_000589156.1
Location: 60510..60755 (246 bp)
Type: Antitoxin
Protein ID: WP_000643598.1
Type: Antitoxin
Protein ID: WP_000643598.1
Location: 60851..61645 (795 bp)
Type: Others
Protein ID: WP_001911581.1
Type: Others
Protein ID: WP_001911581.1
Location: 61748..61876 (129 bp)
Type: Others
Protein ID: WP_071908338.1
Type: Others
Protein ID: WP_071908338.1
Location: 61937..62119 (183 bp)
Type: Others
Protein ID: WP_000923182.1
Type: Others
Protein ID: WP_000923182.1
Location: 62335..63339 (1005 bp)
Type: Others
Protein ID: WP_000964920.1
Type: Others
Protein ID: WP_000964920.1
Location: 63492..63851 (360 bp)
Type: Others
Protein ID: WP_001071541.1
Type: Others
Protein ID: WP_001071541.1
Location: 64124..64357 (234 bp)
Type: Others
Protein ID: WP_001890112.1
Type: Others
Protein ID: WP_001890112.1
Location: 64625..65131 (507 bp)
Type: Others
Protein ID: WP_000393074.1
Type: Others
Protein ID: WP_000393074.1
Location: 65288..65674 (387 bp)
Type: Others
Protein ID: WP_000703163.1
Type: Others
Protein ID: WP_000703163.1
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
EN18_RS21105 | 55678..55884 | + | 207 | Protein_69 | DUF3709 domain-containing protein | - |
EN18_RS21110 | 56084..56185 | + | 102 | WP_001921603.1 | hypothetical protein | - |
EN18_RS14450 | 56175..56561 | + | 387 | WP_000703163.1 | VOC family protein | - |
EN18_RS14455 | 56756..57007 | + | 252 | WP_001890111.1 | TIGR03643 family protein | - |
EN18_RS20520 | 56980..57129 | + | 150 | WP_071908333.1 | DUF3265 domain-containing protein | - |
EN18_RS14460 | 57221..57463 | + | 243 | WP_000107461.1 | hypothetical protein | - |
EN18_RS14465 | 57715..57993 | + | 279 | WP_000280324.1 | DUF3709 domain-containing protein | - |
EN18_RS21540 | 58368..58511 | + | 144 | Protein_76 | DUF645 family protein | - |
EN18_RS21545 | 58565..58603 | + | 39 | WP_082798268.1 | hypothetical protein | - |
EN18_RS14475 | 58815..59282 | + | 468 | WP_001289288.1 | OsmC family protein | - |
EN18_RS14480 | 59410..60072 | + | 663 | WP_000960654.1 | hypothetical protein | - |
EN18_RS14485 | 60257..60523 | + | 267 | WP_000589156.1 | BrnT family toxin | Toxin |
EN18_RS14490 | 60510..60755 | + | 246 | WP_000643598.1 | hypothetical protein | Antitoxin |
EN18_RS14495 | 60851..61645 | + | 795 | WP_001911581.1 | hypothetical protein | - |
EN18_RS21550 | 61748..61876 | + | 129 | WP_071908338.1 | general secretion pathway protein GspI | - |
EN18_RS14500 | 61937..62119 | + | 183 | WP_000923182.1 | DUF645 family protein | - |
EN18_RS14505 | 62335..63339 | + | 1005 | WP_000964920.1 | LD-carboxypeptidase | - |
EN18_RS14510 | 63492..63851 | + | 360 | WP_001071541.1 | VOC family protein | - |
EN18_RS14515 | 64124..64357 | + | 234 | WP_001890112.1 | DUF3709 domain-containing protein | - |
EN18_RS14520 | 64625..65131 | + | 507 | WP_000393074.1 | hypothetical protein | - |
EN18_RS14525 | 65288..65674 | + | 387 | WP_000703163.1 | VOC family protein | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | catB9 | - | 31037..137542 | 106505 | |
inside | Integron | - | - | 36117..137166 | 101049 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 89 a.a. Molecular weight: 10092.34 Da Isoelectric Point: 7.3171
>T46752 WP_000589156.1 NZ_CP007635:60257-60523 [Vibrio cholerae]
MIKFEFDENKSRSNLEKHGIDFHTAQGLWNDSDLIEIPANTSDEPRYLVVGLLNGKHWSGVITYRGTNIRIISVRRSRKA
EVSLYESA
MIKFEFDENKSRSNLEKHGIDFHTAQGLWNDSDLIEIPANTSDEPRYLVVGLLNGKHWSGVITYRGTNIRIISVRRSRKA
EVSLYESA
Download Length: 267 bp
>T46752 NZ_CP007635:60257-60523 [Vibrio cholerae]
ATGATTAAATTTGAATTTGATGAAAACAAAAGCAGAAGTAATCTCGAAAAGCACGGTATTGATTTTCATACAGCTCAAGG
ATTGTGGAATGATTCAGATCTTATCGAGATCCCTGCTAACACGAGTGATGAGCCCAGATATTTGGTTGTCGGCTTACTAA
ACGGTAAGCATTGGTCAGGAGTAATTACCTACCGAGGTACGAATATCAGGATCATCTCAGTTCGGCGTTCACGGAAAGCG
GAGGTAAGCCTTTATGAAAGCGCATGA
ATGATTAAATTTGAATTTGATGAAAACAAAAGCAGAAGTAATCTCGAAAAGCACGGTATTGATTTTCATACAGCTCAAGG
ATTGTGGAATGATTCAGATCTTATCGAGATCCCTGCTAACACGAGTGATGAGCCCAGATATTTGGTTGTCGGCTTACTAA
ACGGTAAGCATTGGTCAGGAGTAATTACCTACCGAGGTACGAATATCAGGATCATCTCAGTTCGGCGTTCACGGAAAGCG
GAGGTAAGCCTTTATGAAAGCGCATGA
Antitoxin
Download Length: 82 a.a. Molecular weight: 9478.77 Da Isoelectric Point: 6.4832
>AT46752 WP_000643598.1 NZ_CP007635:60510-60755 [Vibrio cholerae]
MKAHEFDAKFESDDDDIVMDLDLSQAKRPMHKQKRVNVDFPAWMLESLDREASRIGVTRQSIIKIWLAERLESVSHHSSV
R
MKAHEFDAKFESDDDDIVMDLDLSQAKRPMHKQKRVNVDFPAWMLESLDREASRIGVTRQSIIKIWLAERLESVSHHSSV
R
Download Length: 246 bp
>AT46752 NZ_CP007635:60510-60755 [Vibrio cholerae]
ATGAAAGCGCATGAATTTGATGCCAAGTTTGAAAGTGACGACGATGATATCGTAATGGACTTGGATCTATCGCAAGCTAA
AAGACCGATGCATAAGCAAAAACGAGTCAATGTAGATTTTCCAGCCTGGATGCTTGAGTCCTTGGACAGAGAAGCGAGTC
GTATTGGTGTAACACGTCAATCAATCATTAAAATTTGGCTGGCAGAAAGGTTAGAGAGCGTGTCTCATCATTCAAGTGTG
AGATAA
ATGAAAGCGCATGAATTTGATGCCAAGTTTGAAAGTGACGACGATGATATCGTAATGGACTTGGATCTATCGCAAGCTAA
AAGACCGATGCATAAGCAAAAACGAGTCAATGTAGATTTTCCAGCCTGGATGCTTGAGTCCTTGGACAGAGAAGCGAGTC
GTATTGGTGTAACACGTCAATCAATCATTAAAATTTGGCTGGCAGAAAGGTTAGAGAGCGTGTCTCATCATTCAAGTGTG
AGATAA
Structures
Toxin
Loading, please wait
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A271VMP7 |
Antitoxin
Loading, please wait
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A271VME2 |