Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | dhiT-phd/- |
Location | 131448..131852 | Replicon | chromosome |
Accession | NC_016446 | ||
Organism | Vibrio cholerae O1 str. 2010EL-1786 |
Toxin (Protein)
Gene name | dhiT | Uniprot ID | A0A086SLD6 |
Locus tag | HJ37_RS14900 | Protein ID | WP_001114075.1 |
Coordinates | 131583..131852 (+) | Length | 90 a.a. |
Antitoxin (Protein)
Gene name | phd | Uniprot ID | - |
Locus tag | HJ37_RS20045 | Protein ID | WP_099607150.1 |
Coordinates | 131448..131552 (+) | Length | 35 a.a. |
Genomic Context
Location: 126949..127866 (918 bp)
Type: Others
Protein ID: WP_000186333.1
Type: Others
Protein ID: WP_000186333.1
Location: 128023..128412 (390 bp)
Type: Others
Protein ID: WP_001081302.1
Type: Others
Protein ID: WP_001081302.1
Location: 128548..128757 (210 bp)
Type: Others
Protein ID: Protein_202
Type: Others
Protein ID: Protein_202
Location: 128876..129313 (438 bp)
Type: Others
Protein ID: WP_000503169.1
Type: Others
Protein ID: WP_000503169.1
Location: 129377..129595 (219 bp)
Type: Others
Protein ID: WP_071908318.1
Type: Others
Protein ID: WP_071908318.1
Location: 129770..130642 (873 bp)
Type: Others
Protein ID: WP_000254716.1
Type: Others
Protein ID: WP_000254716.1
Location: 130792..131391 (600 bp)
Type: Others
Protein ID: WP_001891245.1
Type: Others
Protein ID: WP_001891245.1
Location: 131448..131552 (105 bp)
Type: Antitoxin
Protein ID: WP_099607150.1
Type: Antitoxin
Protein ID: WP_099607150.1
Location: 131583..131852 (270 bp)
Type: Toxin
Protein ID: WP_001114075.1
Type: Toxin
Protein ID: WP_001114075.1
Location: 131846..132367 (522 bp)
Type: Others
Protein ID: WP_000921691.1
Type: Others
Protein ID: WP_000921691.1
Location: 132666..132791 (126 bp)
Type: Others
Protein ID: WP_001905700.1
Type: Others
Protein ID: WP_001905700.1
Location: 133042..133437 (396 bp)
Type: Others
Protein ID: WP_001000867.1
Type: Others
Protein ID: WP_001000867.1
Location: 134329..134844 (516 bp)
Type: Others
Protein ID: WP_000343779.1
Type: Others
Protein ID: WP_000343779.1
Location: 135028..135441 (414 bp)
Type: Others
Protein ID: WP_000049420.1
Type: Others
Protein ID: WP_000049420.1
Location: 133576..133854 (279 bp)
Type: Others
Protein ID: WP_000578476.1
Type: Others
Protein ID: WP_000578476.1
Location: 133851..134135 (285 bp)
Type: Others
Protein ID: WP_000381183.1
Type: Others
Protein ID: WP_000381183.1
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
HJ37_RS14865 | 126949..127866 | + | 918 | WP_000186333.1 | alpha/beta hydrolase | - |
HJ37_RS14870 | 128023..128412 | + | 390 | WP_001081302.1 | hypothetical protein | - |
HJ37_RS14875 | 128548..128757 | + | 210 | Protein_202 | GNAT family N-acetyltransferase | - |
HJ37_RS14880 | 128876..129313 | + | 438 | WP_000503169.1 | IS200/IS605-like element IS1004 family transposase | - |
HJ37_RS14885 | 129377..129595 | + | 219 | WP_071908318.1 | GNAT family N-acetyltransferase | - |
HJ37_RS14890 | 129770..130642 | + | 873 | WP_000254716.1 | DUF3800 domain-containing protein | - |
HJ37_RS14895 | 130792..131391 | + | 600 | WP_001891245.1 | glutathione S-transferase N-terminal domain-containing protein | - |
HJ37_RS20045 | 131448..131552 | + | 105 | WP_099607150.1 | acetyltransferase | Antitoxin |
HJ37_RS14900 | 131583..131852 | + | 270 | WP_001114075.1 | DUF4160 domain-containing protein | Toxin |
HJ37_RS14905 | 131846..132367 | + | 522 | WP_000921691.1 | DUF2442 domain-containing protein | - |
HJ37_RS20050 | 132666..132791 | + | 126 | WP_001905700.1 | DUF645 family protein | - |
HJ37_RS14910 | 133042..133437 | + | 396 | WP_001000867.1 | hypothetical protein | - |
HJ37_RS14915 | 133576..133854 | - | 279 | WP_000578476.1 | type II toxin-antitoxin system mRNA interferase toxin, RelE/StbE family | - |
HJ37_RS14920 | 133851..134135 | - | 285 | WP_000381183.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | - |
HJ37_RS14925 | 134329..134844 | + | 516 | WP_000343779.1 | GNAT family N-acetyltransferase | - |
HJ37_RS14930 | 135028..135441 | + | 414 | WP_000049420.1 | VOC family protein | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | catB9 | - | 31115..136304 | 105189 | |
inside | Integron | catB9 | - | 36195..135928 | 99733 | ||
flank | IS/Tn | - | - | 128876..129313 | 437 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 90 a.a. Molecular weight: 10310.94 Da Isoelectric Point: 6.6303
>T25720 WP_001114075.1 NC_016446:131583-131852 [Vibrio cholerae O1 str. 2010EL-1786]
MPEIDALLGLSFCLYFFDNKQHKLPHIHVKYGSYELIIAIETGECLEGYLPNKQRKRAENHILEHREQLMVMWNKAVNGE
NPGKLGDLC
MPEIDALLGLSFCLYFFDNKQHKLPHIHVKYGSYELIIAIETGECLEGYLPNKQRKRAENHILEHREQLMVMWNKAVNGE
NPGKLGDLC
Download Length: 270 bp
>T25720 NC_016446:131583-131852 [Vibrio cholerae O1 str. 2010EL-1786]
ATGCCAGAGATTGATGCCCTATTAGGTCTTTCATTTTGCTTGTACTTCTTTGATAACAAGCAGCATAAATTACCTCATAT
TCACGTTAAGTACGGTAGTTACGAGCTAATTATTGCTATTGAAACAGGTGAGTGTTTAGAGGGTTACTTACCCAATAAGC
AACGAAAACGTGCTGAAAACCATATTCTTGAACATCGAGAGCAATTGATGGTGATGTGGAATAAAGCGGTGAATGGTGAA
AATCCAGGTAAGTTAGGTGATTTATGTTGA
ATGCCAGAGATTGATGCCCTATTAGGTCTTTCATTTTGCTTGTACTTCTTTGATAACAAGCAGCATAAATTACCTCATAT
TCACGTTAAGTACGGTAGTTACGAGCTAATTATTGCTATTGAAACAGGTGAGTGTTTAGAGGGTTACTTACCCAATAAGC
AACGAAAACGTGCTGAAAACCATATTCTTGAACATCGAGAGCAATTGATGGTGATGTGGAATAAAGCGGTGAATGGTGAA
AATCCAGGTAAGTTAGGTGATTTATGTTGA
Antitoxin
Download Length: 35 a.a. Molecular weight: 3991.79 Da Isoelectric Point: 9.2853
>AT25720 WP_099607150.1 NC_016446:131448-131552 [Vibrio cholerae O1 str. 2010EL-1786]
VVSVVVFEFSSMRCQPLRRALYAYRNCLLKDTLL
VVSVVVFEFSSMRCQPLRRALYAYRNCLLKDTLL
Download Length: 105 bp
>AT25720 NC_016446:131448-131552 [Vibrio cholerae O1 str. 2010EL-1786]
GTGGTTTCGGTTGTTGTGTTTGAGTTTAGTAGTATGCGCTGCCAGCCCCTTAGGCGGGCGTTATATGCTTATAGGAATTG
TCTCCTAAAGGATACGCTGCTATAG
GTGGTTTCGGTTGTTGTGTTTGAGTTTAGTAGTATGCGCTGCCAGCCCCTTAGGCGGGCGTTATATGCTTATAGGAATTG
TCTCCTAAAGGATACGCTGCTATAG
Structures
Toxin
Loading, please wait
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A086SLD6 |
Antitoxin
Loading, please wait
Source | ID | Structure |
---|---|---|
No matching records found |