Detailed information of TA system    

insolicoBioinformatically predicted

Overview


TA module


Type II Classification (family/domain) relBE/ParE-YafN
Location 277269..277797 Replicon chromosome
Accession NZ_LT992493
Organism Vibrio cholerae strain 4295STDY6534248

Toxin (Protein)


Gene name relE Uniprot ID A0A0X1KZS6
Locus tag DG169_RS16095 Protein ID WP_000221354.1
Coordinates 277510..277797 (+) Length 96 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID A0A0X1KZS8
Locus tag DG169_RS16090 Protein ID WP_001250179.1
Coordinates 277269..277520 (+) Length 84 a.a.

Genomic Context


Locus tag Coordinates Strand Size (bp) Protein ID Product Description
DG169_RS16050 272537..272851 + 315 WP_000071008.1 DNA-binding transcriptional regulator -
DG169_RS16055 272988..273422 + 435 WP_000256036.1 GNAT family N-acetyltransferase -
DG169_RS19685 273590..273745 + 156 WP_000751734.1 hypothetical protein -
DG169_RS16060 273870..274850 - 981 WP_000019370.1 IS5-like element ISVch5 family transposase -
DG169_RS16065 274918..275224 + 307 Protein_305 CatB-related O-acetyltransferase -
DG169_RS16070 275361..276053 + 693 WP_001047169.1 GNAT family N-acetyltransferase -
DG169_RS16075 276053..276454 + 402 WP_000351248.1 type II toxin-antitoxin system death-on-curing family toxin -
DG169_RS16080 276424..276567 + 144 WP_071908341.1 DUF3265 domain-containing protein -
DG169_RS16085 276642..277055 + 414 WP_000049417.1 VOC family protein -
DG169_RS16090 277269..277520 + 252 WP_001250179.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
DG169_RS16095 277510..277797 + 288 WP_000221354.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
DG169_RS16100 277925..278380 + 456 WP_001245327.1 GNAT family N-acetyltransferase -
DG169_RS16105 278702..278854 + 153 WP_001884520.1 DUF645 family protein -
DG169_RS16115 279056..279553 - 498 WP_000982260.1 GNAT family N-acetyltransferase -
DG169_RS16120 279550..279822 - 273 WP_000246253.1 DUF1778 domain-containing protein -
DG169_RS16125 280053..280721 + 669 WP_000043871.1 hypothetical protein -
DG169_RS16130 280873..281160 + 288 WP_000426470.1 hypothetical protein -
DG169_RS16135 281301..281672 + 372 WP_001164080.1 nucleotide pyrophosphohydrolase -
DG169_RS16140 281739..282164 + 426 WP_001882332.1 DUF1778 domain-containing protein -
DG169_RS16145 282161..282694 + 534 WP_000118351.1 GNAT family N-acetyltransferase -

Associated MGEs


MGE
detail
Similar
MGEs
Relative
position
MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Genomic island catB9 - 197768..293032 95264
inside Integron catB9 - 202848..292656 89808
flank IS/Tn - - 273870..274850 980


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.



Sequences


Toxin        


Download         Length: 96 a.a.        Molecular weight: 10991.96 Da        Isoelectric Point: 10.4934

>T294416 WP_000221354.1 NZ_LT992493:277510-277797 [Vibrio cholerae]
MTYKLKFLPAAQKEWSKLAPTIQSQFKKKLKERLENPHVPSAKLRGYDAVYKIKLRTAGYRLAYEVIDDEIVVYVLAVGK
RDKDAVYKKLASRFG

Download         Length: 288 bp


Antitoxin


Download         Length: 84 a.a.        Molecular weight: 9136.29 Da        Isoelectric Point: 4.0197

>AT294416 WP_001250179.1 NZ_LT992493:277269-277520 [Vibrio cholerae]
MRQVLANCSASISELKKNPTALLNEADGSAIAILNHNKPAAYLVPAETYEYLIDMLDDYELSQIVDSRRADLAQAVEVNI
DDL

Download         Length: 252 bp


Similar Proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures


Toxin

Source ID Structure
AlphaFold DB A0A0X1KZS6


Antitoxin

Source ID Structure
AlphaFold DB A0A0X1KZS8

References