Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | relBE/ParE-YafN |
Location | 419819..420347 | Replicon | chromosome II |
Accession | NC_016945 | ||
Organism | Vibrio cholerae IEC224 |
Toxin (Protein)
Gene name | relE | Uniprot ID | A0A0X1KZS6 |
Locus tag | O3Y_RS16175 | Protein ID | WP_000221354.1 |
Coordinates | 420060..420347 (+) | Length | 96 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | A0A0X1KZS8 |
Locus tag | O3Y_RS16170 | Protein ID | WP_001250179.1 |
Coordinates | 419819..420070 (+) | Length | 84 a.a. |
Genomic Context
Location: 415087..415401 (315 bp)
Type: Others
Protein ID: WP_000071008.1
Type: Others
Protein ID: WP_000071008.1
Location: 415538..415972 (435 bp)
Type: Others
Protein ID: WP_000256036.1
Type: Others
Protein ID: WP_000256036.1
Location: 416140..416295 (156 bp)
Type: Others
Protein ID: WP_000751734.1
Type: Others
Protein ID: WP_000751734.1
Location: 417468..417774 (307 bp)
Type: Others
Protein ID: Protein_444
Type: Others
Protein ID: Protein_444
Location: 417911..418603 (693 bp)
Type: Others
Protein ID: WP_001047169.1
Type: Others
Protein ID: WP_001047169.1
Location: 418603..419004 (402 bp)
Type: Others
Protein ID: WP_000351248.1
Type: Others
Protein ID: WP_000351248.1
Location: 418974..419117 (144 bp)
Type: Others
Protein ID: WP_071908341.1
Type: Others
Protein ID: WP_071908341.1
Location: 419192..419605 (414 bp)
Type: Others
Protein ID: WP_000049417.1
Type: Others
Protein ID: WP_000049417.1
Location: 419819..420070 (252 bp)
Type: Antitoxin
Protein ID: WP_001250179.1
Type: Antitoxin
Protein ID: WP_001250179.1
Location: 420060..420347 (288 bp)
Type: Toxin
Protein ID: WP_000221354.1
Type: Toxin
Protein ID: WP_000221354.1
Location: 420475..420930 (456 bp)
Type: Others
Protein ID: WP_001245327.1
Type: Others
Protein ID: WP_001245327.1
Location: 421252..421404 (153 bp)
Type: Others
Protein ID: WP_001884520.1
Type: Others
Protein ID: WP_001884520.1
Location: 422603..423271 (669 bp)
Type: Others
Protein ID: WP_000043871.1
Type: Others
Protein ID: WP_000043871.1
Location: 423423..423710 (288 bp)
Type: Others
Protein ID: WP_000426470.1
Type: Others
Protein ID: WP_000426470.1
Location: 423851..424222 (372 bp)
Type: Others
Protein ID: WP_001164080.1
Type: Others
Protein ID: WP_001164080.1
Location: 424289..424714 (426 bp)
Type: Others
Protein ID: WP_001882332.1
Type: Others
Protein ID: WP_001882332.1
Location: 424711..425244 (534 bp)
Type: Others
Protein ID: WP_000118351.1
Type: Others
Protein ID: WP_000118351.1
Location: 416420..417400 (981 bp)
Type: Others
Protein ID: WP_000019370.1
Type: Others
Protein ID: WP_000019370.1
Location: 421606..422103 (498 bp)
Type: Others
Protein ID: WP_000982260.1
Type: Others
Protein ID: WP_000982260.1
Location: 422100..422372 (273 bp)
Type: Others
Protein ID: WP_000246253.1
Type: Others
Protein ID: WP_000246253.1
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
O3Y_RS16130 | 415087..415401 | + | 315 | WP_000071008.1 | DNA-binding transcriptional regulator | - |
O3Y_RS16135 | 415538..415972 | + | 435 | WP_000256036.1 | GNAT family N-acetyltransferase | - |
O3Y_RS20420 | 416140..416295 | + | 156 | WP_000751734.1 | hypothetical protein | - |
O3Y_RS16145 | 416420..417400 | - | 981 | WP_000019370.1 | IS5-like element ISVch5 family transposase | - |
O3Y_RS16150 | 417468..417774 | + | 307 | Protein_444 | CatB-related O-acetyltransferase | - |
O3Y_RS16155 | 417911..418603 | + | 693 | WP_001047169.1 | GNAT family N-acetyltransferase | - |
O3Y_RS16160 | 418603..419004 | + | 402 | WP_000351248.1 | type II toxin-antitoxin system death-on-curing family toxin | - |
O3Y_RS20335 | 418974..419117 | + | 144 | WP_071908341.1 | DUF3265 domain-containing protein | - |
O3Y_RS16165 | 419192..419605 | + | 414 | WP_000049417.1 | VOC family protein | - |
O3Y_RS16170 | 419819..420070 | + | 252 | WP_001250179.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
O3Y_RS16175 | 420060..420347 | + | 288 | WP_000221354.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
O3Y_RS16180 | 420475..420930 | + | 456 | WP_001245327.1 | GNAT family N-acetyltransferase | - |
O3Y_RS16185 | 421252..421404 | + | 153 | WP_001884520.1 | DUF645 family protein | - |
O3Y_RS16190 | 421606..422103 | - | 498 | WP_000982260.1 | GNAT family N-acetyltransferase | - |
O3Y_RS16195 | 422100..422372 | - | 273 | WP_000246253.1 | DUF1778 domain-containing protein | - |
O3Y_RS16200 | 422603..423271 | + | 669 | WP_000043871.1 | hypothetical protein | - |
O3Y_RS16205 | 423423..423710 | + | 288 | WP_000426470.1 | hypothetical protein | - |
O3Y_RS16210 | 423851..424222 | + | 372 | WP_001164080.1 | nucleotide pyrophosphohydrolase | - |
O3Y_RS16215 | 424289..424714 | + | 426 | WP_001882332.1 | DUF1778 domain-containing protein | - |
O3Y_RS16220 | 424711..425244 | + | 534 | WP_000118351.1 | GNAT family N-acetyltransferase | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | catB9 | - | 304637..435582 | 130945 | |
inside | Integron | - | - | 309717..435206 | 125489 | ||
flank | IS/Tn | - | - | 416420..417400 | 980 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 96 a.a. Molecular weight: 10991.96 Da Isoelectric Point: 10.4934
>T26154 WP_000221354.1 NC_016945:420060-420347 [Vibrio cholerae IEC224]
MTYKLKFLPAAQKEWSKLAPTIQSQFKKKLKERLENPHVPSAKLRGYDAVYKIKLRTAGYRLAYEVIDDEIVVYVLAVGK
RDKDAVYKKLASRFG
MTYKLKFLPAAQKEWSKLAPTIQSQFKKKLKERLENPHVPSAKLRGYDAVYKIKLRTAGYRLAYEVIDDEIVVYVLAVGK
RDKDAVYKKLASRFG
Download Length: 288 bp
>T26154 NC_016945:420060-420347 [Vibrio cholerae IEC224]
ATGACCTATAAGTTAAAGTTTCTGCCGGCTGCGCAAAAGGAATGGAGTAAGTTAGCTCCGACAATTCAGAGTCAGTTCAA
GAAGAAGTTAAAGGAACGATTAGAAAATCCGCACGTCCCTTCGGCTAAGCTTCGAGGATACGACGCTGTTTACAAGATTA
AACTTCGTACGGCGGGTTATCGTTTAGCTTATGAGGTTATTGACGATGAGATAGTTGTCTATGTCCTTGCTGTCGGTAAA
CGTGACAAAGATGCTGTCTATAAAAAACTGGCTTCACGCTTCGGTTAG
ATGACCTATAAGTTAAAGTTTCTGCCGGCTGCGCAAAAGGAATGGAGTAAGTTAGCTCCGACAATTCAGAGTCAGTTCAA
GAAGAAGTTAAAGGAACGATTAGAAAATCCGCACGTCCCTTCGGCTAAGCTTCGAGGATACGACGCTGTTTACAAGATTA
AACTTCGTACGGCGGGTTATCGTTTAGCTTATGAGGTTATTGACGATGAGATAGTTGTCTATGTCCTTGCTGTCGGTAAA
CGTGACAAAGATGCTGTCTATAAAAAACTGGCTTCACGCTTCGGTTAG
Antitoxin
Download Length: 84 a.a. Molecular weight: 9136.29 Da Isoelectric Point: 4.0197
>AT26154 WP_001250179.1 NC_016945:419819-420070 [Vibrio cholerae IEC224]
MRQVLANCSASISELKKNPTALLNEADGSAIAILNHNKPAAYLVPAETYEYLIDMLDDYELSQIVDSRRADLAQAVEVNI
DDL
MRQVLANCSASISELKKNPTALLNEADGSAIAILNHNKPAAYLVPAETYEYLIDMLDDYELSQIVDSRRADLAQAVEVNI
DDL
Download Length: 252 bp
>AT26154 NC_016945:419819-420070 [Vibrio cholerae IEC224]
ATGAGACAAGTTTTAGCGAATTGCTCTGCAAGTATTTCAGAGTTAAAGAAGAACCCAACAGCTTTGTTGAATGAGGCTGA
TGGGTCTGCAATTGCAATTTTAAACCACAACAAGCCAGCGGCTTACCTTGTGCCAGCGGAAACGTATGAGTATCTCATCG
ATATGCTCGATGATTATGAGCTTTCCCAAATTGTCGATAGTCGCCGAGCTGACTTAGCACAAGCTGTGGAAGTAAATATT
GATGACCTATAA
ATGAGACAAGTTTTAGCGAATTGCTCTGCAAGTATTTCAGAGTTAAAGAAGAACCCAACAGCTTTGTTGAATGAGGCTGA
TGGGTCTGCAATTGCAATTTTAAACCACAACAAGCCAGCGGCTTACCTTGTGCCAGCGGAAACGTATGAGTATCTCATCG
ATATGCTCGATGATTATGAGCTTTCCCAAATTGTCGATAGTCGCCGAGCTGACTTAGCACAAGCTGTGGAAGTAAATATT
GATGACCTATAA
Structures
Toxin
Loading, please wait
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0X1KZS6 |
Antitoxin
Loading, please wait
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0X1KZS8 |