Detailed information of TA system    

insolicoBioinformatically predicted

Overview


TA module


Type II Classification (family/domain) relBE/ParE-YafN
Location 804594..805122 Replicon chromosome
Accession NZ_CP102928
Organism Vibrio cholerae strain N1252

Toxin (Protein)


Gene name relE Uniprot ID A0A0X1KZS6
Locus tag NW313_RS17850 Protein ID WP_000221354.1
Coordinates 804835..805122 (+) Length 96 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID A0A0X1KZS8
Locus tag NW313_RS17845 Protein ID WP_001250179.1
Coordinates 804594..804845 (+) Length 84 a.a.

Genomic Context


Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NW313_RS17795 799862..800176 + 315 WP_000071008.1 DNA-binding transcriptional regulator -
NW313_RS17800 800313..800747 + 435 WP_000256036.1 GNAT family N-acetyltransferase -
NW313_RS17805 800915..801070 + 156 WP_000751734.1 hypothetical protein -
NW313_RS17810 801195..802175 - 981 WP_000019370.1 IS5-like element ISVch5 family transposase -
NW313_RS17815 802243..802549 + 307 Protein_786 CatB-related O-acetyltransferase -
NW313_RS17820 802686..803084 + 399 Protein_787 GNAT family N-acetyltransferase -
NW313_RS17825 803208..803378 + 171 WP_001080654.1 hypothetical protein -
NW313_RS17830 803378..803779 + 402 WP_000351248.1 type II toxin-antitoxin system death-on-curing family toxin -
NW313_RS17835 803782..803892 + 111 WP_082798255.1 DUF3265 domain-containing protein -
NW313_RS17840 803967..804380 + 414 WP_000049417.1 VOC family protein -
NW313_RS17845 804594..804845 + 252 WP_001250179.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
NW313_RS17850 804835..805122 + 288 WP_000221354.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
NW313_RS17855 805250..805705 + 456 WP_001245327.1 GNAT family N-acetyltransferase -
NW313_RS17860 805762..805884 + 123 Protein_795 acetyltransferase -
NW313_RS17865 806055..806179 + 125 Protein_796 DUF645 family protein -
NW313_RS17870 806296..806364 + 69 Protein_797 acetyltransferase -
NW313_RS17875 806381..806878 - 498 WP_000982260.1 GNAT family N-acetyltransferase -
NW313_RS17880 806875..807147 - 273 WP_000246253.1 DUF1778 domain-containing protein -
NW313_RS17885 807299..807361 + 63 Protein_800 acetyltransferase -
NW313_RS17890 807378..808046 + 669 WP_000043871.1 hypothetical protein -
NW313_RS17895 808198..808485 + 288 WP_000426470.1 hypothetical protein -
NW313_RS17900 808626..808997 + 372 WP_001164080.1 MazG nucleotide pyrophosphohydrolase domain-containing protein -
NW313_RS17905 809220..809489 + 270 WP_000179600.1 DUF1778 domain-containing protein -
NW313_RS17910 809486..810019 + 534 WP_000118351.1 GNAT family N-acetyltransferase -

Associated MGEs


MGE
detail
Similar
MGEs
Relative
position
MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Genomic island catB9 - 713852..820357 106505
inside Integron catB9 - 718932..819981 101049
flank IS/Tn - - 801195..802175 980


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.



Sequences


Toxin        


Download         Length: 96 a.a.        Molecular weight: 10991.96 Da        Isoelectric Point: 10.4934

>T254476 WP_000221354.1 NZ_CP102928:804835-805122 [Vibrio cholerae]
MTYKLKFLPAAQKEWSKLAPTIQSQFKKKLKERLENPHVPSAKLRGYDAVYKIKLRTAGYRLAYEVIDDEIVVYVLAVGK
RDKDAVYKKLASRFG

Download         Length: 288 bp


Antitoxin


Download         Length: 84 a.a.        Molecular weight: 9136.29 Da        Isoelectric Point: 4.0197

>AT254476 WP_001250179.1 NZ_CP102928:804594-804845 [Vibrio cholerae]
MRQVLANCSASISELKKNPTALLNEADGSAIAILNHNKPAAYLVPAETYEYLIDMLDDYELSQIVDSRRADLAQAVEVNI
DDL

Download         Length: 252 bp


Similar Proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures


Toxin

Source ID Structure
AlphaFold DB A0A0X1KZS6


Antitoxin

Source ID Structure
AlphaFold DB A0A0X1KZS8

References