Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | parDE/ParE-Phd |
Location | 363565..364143 | Replicon | chromosome |
Accession | NZ_CP024868 | ||
Organism | Vibrio cholerae strain A1552 |
Toxin (Protein)
Gene name | parE | Uniprot ID | O68848 |
Locus tag | VCA1552_RS16190 | Protein ID | WP_001180243.1 |
Coordinates | 363565..363882 (-) | Length | 106 a.a. |
Antitoxin (Protein)
Gene name | parD | Uniprot ID | Q7DCR7 |
Locus tag | VCA1552_RS16195 | Protein ID | WP_000557292.1 |
Coordinates | 363901..364143 (-) | Length | 81 a.a. |
Genomic Context
Location: 358756..359151 (396 bp)
Type: Others
Protein ID: WP_000046952.1
Type: Others
Protein ID: WP_000046952.1
Location: 359454..359635 (182 bp)
Type: Others
Protein ID: Protein_346
Type: Others
Protein ID: Protein_346
Location: 359812..360207 (396 bp)
Type: Others
Protein ID: WP_000046953.1
Type: Others
Protein ID: WP_000046953.1
Location: 360351..360887 (537 bp)
Type: Others
Protein ID: WP_000644491.1
Type: Others
Protein ID: WP_000644491.1
Location: 361184..361363 (180 bp)
Type: Others
Protein ID: WP_001883039.1
Type: Others
Protein ID: WP_001883039.1
Location: 361559..361984 (426 bp)
Type: Others
Protein ID: WP_000403014.1
Type: Others
Protein ID: WP_000403014.1
Location: 362133..362480 (348 bp)
Type: Others
Protein ID: WP_000933409.1
Type: Others
Protein ID: WP_000933409.1
Location: 362627..362920 (294 bp)
Type: Others
Protein ID: WP_125460920.1
Type: Others
Protein ID: WP_125460920.1
Location: 363276..363371 (96 bp)
Type: Others
Protein ID: WP_001907607.1
Type: Others
Protein ID: WP_001907607.1
Location: 364385..364894 (510 bp)
Type: Others
Protein ID: WP_000405987.1
Type: Others
Protein ID: WP_000405987.1
Location: 364951..365604 (654 bp)
Type: Others
Protein ID: WP_000226874.1
Type: Others
Protein ID: WP_000226874.1
Location: 365914..366132 (219 bp)
Type: Others
Protein ID: WP_001917086.1
Type: Others
Protein ID: WP_001917086.1
Location: 366535..366768 (234 bp)
Type: Others
Protein ID: WP_032482776.1
Type: Others
Protein ID: WP_032482776.1
Location: 367193..367373 (181 bp)
Type: Others
Protein ID: Protein_360
Type: Others
Protein ID: Protein_360
Location: 367640..367927 (288 bp)
Type: Others
Protein ID: WP_001162670.1
Type: Others
Protein ID: WP_001162670.1
Location: 367938..368255 (318 bp)
Type: Others
Protein ID: WP_001232701.1
Type: Others
Protein ID: WP_001232701.1
Location: 368252..368362 (111 bp)
Type: Others
Protein ID: WP_134814058.1
Type: Others
Protein ID: WP_134814058.1
Location: 368539..368664 (126 bp)
Type: Others
Protein ID: WP_001944767.1
Type: Others
Protein ID: WP_001944767.1
Location: 368680..368718 (39 bp)
Type: Others
Protein ID: WP_106019119.1
Type: Others
Protein ID: WP_106019119.1
Location: 363565..363882 (318 bp)
Type: Toxin
Protein ID: WP_001180243.1
Type: Toxin
Protein ID: WP_001180243.1
Location: 363901..364143 (243 bp)
Type: Antitoxin
Protein ID: WP_000557292.1
Type: Antitoxin
Protein ID: WP_000557292.1
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
VCA1552_RS16140 | 358756..359151 | + | 396 | WP_000046952.1 | hypothetical protein | - |
VCA1552_RS16145 | 359454..359635 | + | 182 | Protein_346 | DUF645 family protein | - |
VCA1552_RS16150 | 359812..360207 | + | 396 | WP_000046953.1 | hypothetical protein | - |
VCA1552_RS16155 | 360351..360887 | + | 537 | WP_000644491.1 | nucleotidyltransferase family protein | - |
VCA1552_RS16160 | 361184..361363 | + | 180 | WP_001883039.1 | DUF645 family protein | - |
VCA1552_RS16165 | 361559..361984 | + | 426 | WP_000403014.1 | GNAT family N-acetyltransferase | - |
VCA1552_RS16170 | 362133..362480 | + | 348 | WP_000933409.1 | hypothetical protein | - |
VCA1552_RS19855 | 362627..362920 | + | 294 | WP_125460920.1 | hypothetical protein | - |
VCA1552_RS20000 | 363276..363371 | + | 96 | WP_001907607.1 | DUF645 family protein | - |
VCA1552_RS16190 | 363565..363882 | - | 318 | WP_001180243.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
VCA1552_RS16195 | 363901..364143 | - | 243 | WP_000557292.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
VCA1552_RS16200 | 364385..364894 | + | 510 | WP_000405987.1 | GNAT family N-acetyltransferase | - |
VCA1552_RS16205 | 364951..365604 | + | 654 | WP_000226874.1 | hypothetical protein | - |
VCA1552_RS16210 | 365914..366132 | + | 219 | WP_001917086.1 | DUF3709 domain-containing protein | - |
VCA1552_RS16215 | 366535..366768 | + | 234 | WP_032482776.1 | DUF3709 domain-containing protein | - |
VCA1552_RS16220 | 367193..367373 | + | 181 | Protein_360 | DUF645 family protein | - |
VCA1552_RS16230 | 367640..367927 | + | 288 | WP_001162670.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
VCA1552_RS16235 | 367938..368255 | + | 318 | WP_001232701.1 | HigA family addiction module antidote protein | - |
VCA1552_RS20005 | 368252..368362 | + | 111 | WP_134814058.1 | DUF3265 domain-containing protein | - |
VCA1552_RS16250 | 368539..368664 | + | 126 | WP_001944767.1 | DUF645 family protein | - |
VCA1552_RS16255 | 368680..368718 | + | 39 | WP_106019119.1 | hypothetical protein | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | catB9 | - | 304717..433978 | 129261 | |
inside | Integron | - | - | 309797..433602 | 123805 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 106 a.a. Molecular weight: 12158.97 Da Isoelectric Point: 9.7495
>T88993 WP_001180243.1 NZ_CP024868:c363882-363565 [Vibrio cholerae]
MQNKQYKLSQLAQEHLLKIKHYTIENFAEAQWQKYKSTLLSGFQTLADNPGLGKSCEDIYQNGFYFPVGKHMAYYTKEAN
FILIVAVLGQSQLPQKHLKQSRFVS
MQNKQYKLSQLAQEHLLKIKHYTIENFAEAQWQKYKSTLLSGFQTLADNPGLGKSCEDIYQNGFYFPVGKHMAYYTKEAN
FILIVAVLGQSQLPQKHLKQSRFVS
Download Length: 318 bp
>T88993 NZ_CP024868:c363882-363565 [Vibrio cholerae]
ATGCAAAATAAACAATATAAGCTCAGCCAATTAGCCCAAGAGCACTTACTCAAGATTAAACACTACACCATTGAAAATTT
CGCTGAAGCGCAGTGGCAAAAATATAAGTCGACCTTGCTTTCAGGTTTCCAAACTCTTGCGGATAACCCAGGACTAGGAA
AAAGCTGTGAAGATATTTACCAAAATGGTTTTTACTTTCCAGTGGGGAAACACATGGCTTATTACACCAAAGAAGCAAAC
TTCATTCTCATTGTTGCGGTATTAGGGCAATCACAACTGCCCCAAAAGCATCTCAAACAGTCACGCTTTGTTTCTTAG
ATGCAAAATAAACAATATAAGCTCAGCCAATTAGCCCAAGAGCACTTACTCAAGATTAAACACTACACCATTGAAAATTT
CGCTGAAGCGCAGTGGCAAAAATATAAGTCGACCTTGCTTTCAGGTTTCCAAACTCTTGCGGATAACCCAGGACTAGGAA
AAAGCTGTGAAGATATTTACCAAAATGGTTTTTACTTTCCAGTGGGGAAACACATGGCTTATTACACCAAAGAAGCAAAC
TTCATTCTCATTGTTGCGGTATTAGGGCAATCACAACTGCCCCAAAAGCATCTCAAACAGTCACGCTTTGTTTCTTAG
Antitoxin
Download Length: 81 a.a. Molecular weight: 8961.25 Da Isoelectric Point: 5.6630
>AT88993 WP_000557292.1 NZ_CP024868:c364143-363901 [Vibrio cholerae]
MHTLTANDAKRNFGELLLSAQREPVIISKNSKNTVVVMSIKDFEELEAMKLDYLKHCFESAQKDLDSGKTVDGATFLNTL
MHTLTANDAKRNFGELLLSAQREPVIISKNSKNTVVVMSIKDFEELEAMKLDYLKHCFESAQKDLDSGKTVDGATFLNTL
Download Length: 243 bp
>AT88993 NZ_CP024868:c364143-363901 [Vibrio cholerae]
ATGCACACACTAACAGCAAATGATGCTAAACGAAATTTTGGTGAACTTCTTCTAAGCGCACAACGCGAACCTGTCATCAT
CAGCAAAAACAGTAAGAATACTGTCGTTGTCATGTCCATTAAGGACTTTGAAGAACTTGAAGCAATGAAACTCGATTATC
TCAAACACTGCTTTGAGTCTGCTCAGAAAGACTTAGATAGTGGCAAAACCGTTGATGGTGCCACTTTTCTAAACACCCTT
TGA
ATGCACACACTAACAGCAAATGATGCTAAACGAAATTTTGGTGAACTTCTTCTAAGCGCACAACGCGAACCTGTCATCAT
CAGCAAAAACAGTAAGAATACTGTCGTTGTCATGTCCATTAAGGACTTTGAAGAACTTGAAGCAATGAAACTCGATTATC
TCAAACACTGCTTTGAGTCTGCTCAGAAAGACTTAGATAGTGGCAAAACCGTTGATGGTGCCACTTTTCTAAACACCCTT
TGA
Structures
Toxin
Loading, please wait
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0K9UJR8 |
Antitoxin
Loading, please wait
Source | ID | Structure |
---|---|---|
AlphaFold DB | Q7DCR7 |