Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | /GNAT-DUF1778 |
| Location | 442434..443200 | Replicon | chromosome |
| Accession | NZ_OW443148 | ||
| Organism | Vibrio cholerae strain CNRVC190243 isolate YE-NCPHL-19014-PI | ||
Toxin (Protein)
| Gene name | - | Uniprot ID | Q9K2P7 |
| Locus tag | OC617_RS16260 | Protein ID | WP_000982260.1 |
| Coordinates | 442434..442931 (-) | Length | 166 a.a. |
Antitoxin (Protein)
| Gene name | - | Uniprot ID | Q9K2J6 |
| Locus tag | OC617_RS16265 | Protein ID | WP_000246253.1 |
| Coordinates | 442928..443200 (-) | Length | 91 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OC617_RS16200 (CNRVC190243H_03177) | 438296..438602 | + | 307 | Protein_462 | CatB-related O-acetyltransferase | - |
| OC617_RS16205 | 438739..439137 | + | 399 | Protein_463 | GNAT family N-acetyltransferase | - |
| OC617_RS16210 | 439261..439431 | + | 171 | WP_001080654.1 | hypothetical protein | - |
| OC617_RS16215 (CNRVC190243H_03179) | 439431..439832 | + | 402 | WP_000351248.1 | type II toxin-antitoxin system death-on-curing family toxin | - |
| OC617_RS16220 | 439835..439945 | + | 111 | WP_082798255.1 | DUF3265 domain-containing protein | - |
| OC617_RS16225 (CNRVC190243H_03180) | 440020..440433 | + | 414 | WP_000049417.1 | VOC family protein | - |
| OC617_RS16230 (CNRVC190243H_03181) | 440647..440898 | + | 252 | WP_001250179.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | - |
| OC617_RS16235 (CNRVC190243H_03182) | 440888..441175 | + | 288 | WP_000221354.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
| OC617_RS16240 (CNRVC190243H_03183) | 441303..441758 | + | 456 | WP_001245327.1 | GNAT family N-acetyltransferase | - |
| OC617_RS16245 | 441815..441937 | + | 123 | Protein_471 | acetyltransferase | - |
| OC617_RS16250 | 442108..442232 | + | 125 | Protein_472 | DUF645 family protein | - |
| OC617_RS16255 | 442349..442417 | + | 69 | Protein_473 | acetyltransferase | - |
| OC617_RS16260 (CNRVC190243H_03184) | 442434..442931 | - | 498 | WP_000982260.1 | GNAT family N-acetyltransferase | Toxin |
| OC617_RS16265 (CNRVC190243H_03185) | 442928..443200 | - | 273 | WP_000246253.1 | DUF1778 domain-containing protein | Antitoxin |
| OC617_RS16270 | 443352..443414 | + | 63 | Protein_476 | acetyltransferase | - |
| OC617_RS16275 (CNRVC190243H_03186) | 443431..444099 | + | 669 | WP_000043871.1 | hypothetical protein | - |
| OC617_RS16280 (CNRVC190243H_03187) | 444251..444538 | + | 288 | WP_000426470.1 | hypothetical protein | - |
| OC617_RS16285 (CNRVC190243H_03188) | 444679..445050 | + | 372 | WP_001164080.1 | MazG nucleotide pyrophosphohydrolase domain-containing protein | - |
| OC617_RS16290 (CNRVC190243H_03189) | 445273..445542 | + | 270 | WP_000179600.1 | DUF1778 domain-containing protein | - |
| OC617_RS16295 (CNRVC190243H_03190) | 445539..446072 | + | 534 | WP_000118351.1 | GNAT family N-acetyltransferase | - |
| OC617_RS16300 | 446082..446192 | + | 111 | WP_086010065.1 | DUF3265 domain-containing protein | - |
| OC617_RS16305 (CNRVC190243H_03191) | 446274..446531 | + | 258 | WP_000861987.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | - |
| OC617_RS16310 (CNRVC190243H_03192) | 446519..446821 | + | 303 | WP_000229317.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
| OC617_RS16315 (CNRVC190243H_03193) | 447055..447972 | + | 918 | WP_000186333.1 | alpha/beta hydrolase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | catB9 | - | 349905..456410 | 106505 | |
| inside | Integron | catB9 | - | 354985..456034 | 101049 | ||
| flank | IS/Tn | - | - | 437248..438228 | 980 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 166 a.a. Molecular weight: 18527.18 Da Isoelectric Point: 8.7753
>T295398 WP_000982260.1 NZ_OW443148:c442931-442434 [Vibrio cholerae]
MMNTVLLDKDKHDRNRFNCGTEALNNYLKVMASQQAKKDNTRTFVLEDDNNSAYIIGFYTLTMTPIDLKALPDKLQKKHQ
SSTSGGLIARLAVDDRYKGKGFGEWLLIDALRKLLAASDSVAFPVVIVDAKDGAKHFYERYGFQAFQDAENKLFITIADI
RASLG
MMNTVLLDKDKHDRNRFNCGTEALNNYLKVMASQQAKKDNTRTFVLEDDNNSAYIIGFYTLTMTPIDLKALPDKLQKKHQ
SSTSGGLIARLAVDDRYKGKGFGEWLLIDALRKLLAASDSVAFPVVIVDAKDGAKHFYERYGFQAFQDAENKLFITIADI
RASLG
Download Length: 498 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0Q0KGB1 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| PDB | 1Y9B | |
| AlphaFold DB | A0A0F2IC79 |