Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | phd-doc/Doc-GNAT |
Location | 914103..915196 | Replicon | chromosome |
Accession | NZ_LT992487 | ||
Organism | Vibrio cholerae strain 4295STDY6534216 |
Toxin (Protein)
Gene name | doc | Uniprot ID | Q9KMA2 |
Locus tag | DG247_RS18500 | Protein ID | WP_000351248.1 |
Coordinates | 914103..914504 (-) | Length | 134 a.a. |
Antitoxin (Protein)
Gene name | phd | Uniprot ID | - |
Locus tag | DG247_RS18505 | Protein ID | WP_001047169.1 |
Coordinates | 914504..915196 (-) | Length | 231 a.a. |
Genomic Context
Location: 910735..911007 (273 bp)
Type: Others
Protein ID: WP_000246253.1
Type: Others
Protein ID: WP_000246253.1
Location: 911004..911501 (498 bp)
Type: Others
Protein ID: WP_000982260.1
Type: Others
Protein ID: WP_000982260.1
Location: 915707..916687 (981 bp)
Type: Others
Protein ID: WP_000019370.1
Type: Others
Protein ID: WP_000019370.1
Location: 909397..909684 (288 bp)
Type: Others
Protein ID: WP_000426470.1
Type: Others
Protein ID: WP_000426470.1
Location: 909836..910504 (669 bp)
Type: Others
Protein ID: WP_000043871.1
Type: Others
Protein ID: WP_000043871.1
Location: 911703..911855 (153 bp)
Type: Others
Protein ID: WP_001884520.1
Type: Others
Protein ID: WP_001884520.1
Location: 912177..912632 (456 bp)
Type: Others
Protein ID: WP_001245327.1
Type: Others
Protein ID: WP_001245327.1
Location: 912760..913047 (288 bp)
Type: Others
Protein ID: WP_000221354.1
Type: Others
Protein ID: WP_000221354.1
Location: 913037..913288 (252 bp)
Type: Others
Protein ID: WP_001250179.1
Type: Others
Protein ID: WP_001250179.1
Location: 913502..913915 (414 bp)
Type: Others
Protein ID: WP_000049417.1
Type: Others
Protein ID: WP_000049417.1
Location: 913990..914133 (144 bp)
Type: Others
Protein ID: WP_071908341.1
Type: Others
Protein ID: WP_071908341.1
Location: 914103..914504 (402 bp)
Type: Toxin
Protein ID: WP_000351248.1
Type: Toxin
Protein ID: WP_000351248.1
Location: 914504..915196 (693 bp)
Type: Antitoxin
Protein ID: WP_001047169.1
Type: Antitoxin
Protein ID: WP_001047169.1
Location: 915333..915639 (307 bp)
Type: Others
Protein ID: Protein_787
Type: Others
Protein ID: Protein_787
Location: 916812..916967 (156 bp)
Type: Others
Protein ID: WP_000751734.1
Type: Others
Protein ID: WP_000751734.1
Location: 917135..917569 (435 bp)
Type: Others
Protein ID: WP_000256036.1
Type: Others
Protein ID: WP_000256036.1
Location: 917706..918020 (315 bp)
Type: Others
Protein ID: WP_000071008.1
Type: Others
Protein ID: WP_000071008.1
Location: 918007..918339 (333 bp)
Type: Others
Protein ID: WP_000843587.1
Type: Others
Protein ID: WP_000843587.1
Location: 918680..918907 (228 bp)
Type: Others
Protein ID: WP_001894457.1
Type: Others
Protein ID: WP_001894457.1
Location: 918856..918969 (114 bp)
Type: Others
Protein ID: WP_001889158.1
Type: Others
Protein ID: WP_001889158.1
Location: 919135..919416 (282 bp)
Type: Others
Protein ID: WP_001894453.1
Type: Others
Protein ID: WP_001894453.1
Location: 919365..919479 (115 bp)
Type: Others
Protein ID: Protein_796
Type: Others
Protein ID: Protein_796
Location: 919536..919913 (378 bp)
Type: Others
Protein ID: WP_000411109.1
Type: Others
Protein ID: WP_000411109.1
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
DG247_RS18445 | 909397..909684 | - | 288 | WP_000426470.1 | hypothetical protein | - |
DG247_RS18450 | 909836..910504 | - | 669 | WP_000043871.1 | hypothetical protein | - |
DG247_RS18455 | 910735..911007 | + | 273 | WP_000246253.1 | DUF1778 domain-containing protein | - |
DG247_RS18460 | 911004..911501 | + | 498 | WP_000982260.1 | GNAT family N-acetyltransferase | - |
DG247_RS18470 | 911703..911855 | - | 153 | WP_001884520.1 | DUF645 family protein | - |
DG247_RS18475 | 912177..912632 | - | 456 | WP_001245327.1 | GNAT family N-acetyltransferase | - |
DG247_RS18480 | 912760..913047 | - | 288 | WP_000221354.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
DG247_RS18485 | 913037..913288 | - | 252 | WP_001250179.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | - |
DG247_RS18490 | 913502..913915 | - | 414 | WP_000049417.1 | VOC family protein | - |
DG247_RS18495 | 913990..914133 | - | 144 | WP_071908341.1 | DUF3265 domain-containing protein | - |
DG247_RS18500 | 914103..914504 | - | 402 | WP_000351248.1 | type II toxin-antitoxin system death-on-curing family toxin | Toxin |
DG247_RS18505 | 914504..915196 | - | 693 | WP_001047169.1 | GNAT family N-acetyltransferase | Antitoxin |
DG247_RS18510 | 915333..915639 | - | 307 | Protein_787 | CatB-related O-acetyltransferase | - |
DG247_RS18515 | 915707..916687 | + | 981 | WP_000019370.1 | IS5-like element ISVch5 family transposase | - |
DG247_RS19670 | 916812..916967 | - | 156 | WP_000751734.1 | hypothetical protein | - |
DG247_RS18520 | 917135..917569 | - | 435 | WP_000256036.1 | GNAT family N-acetyltransferase | - |
DG247_RS18525 | 917706..918020 | - | 315 | WP_000071008.1 | DNA-binding transcriptional regulator | - |
DG247_RS18530 | 918007..918339 | - | 333 | WP_000843587.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
DG247_RS18540 | 918680..918907 | - | 228 | WP_001894457.1 | DUF1289 domain-containing protein | - |
DG247_RS19800 | 918856..918969 | - | 114 | WP_001889158.1 | hypothetical protein | - |
DG247_RS18560 | 919135..919416 | - | 282 | WP_001894453.1 | DUF1289 domain-containing protein | - |
DG247_RS19805 | 919365..919479 | - | 115 | Protein_796 | acetyltransferase | - |
DG247_RS18565 | 919536..919913 | - | 378 | WP_000411109.1 | hypothetical protein | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | catB9 | - | 897525..994497 | 96972 | |
inside | Integron | catB9 | - | 897901..987709 | 89808 | ||
flank | IS/Tn | - | - | 915707..916687 | 980 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 134 a.a. Molecular weight: 14608.71 Da Isoelectric Point: 4.0128
>T294355 WP_000351248.1 NZ_LT992487:c914504-914103 [Vibrio cholerae]
MDIICFPFERVIEINAFILKTEPGMKGAVDIPKLQGALGRIDNAIVYEGLDDVFEIAAKYTACIAVSHALPDANKRTGLA
VALEYLSLNDFELTQENDLLADAVRDLVIGIINETDFADILYAQYAKEQNSAL
MDIICFPFERVIEINAFILKTEPGMKGAVDIPKLQGALGRIDNAIVYEGLDDVFEIAAKYTACIAVSHALPDANKRTGLA
VALEYLSLNDFELTQENDLLADAVRDLVIGIINETDFADILYAQYAKEQNSAL
Download Length: 402 bp
Antitoxin
Download Length: 231 a.a. Molecular weight: 26352.73 Da Isoelectric Point: 8.5633
>AT294355 WP_001047169.1 NZ_LT992487:c915196-914504 [Vibrio cholerae]
MNLEEFQESDFDLLIKWIDSDELNYLWGCPAYVFPLTYEQIHSHCSKAEVFPYLLKVKGRHAGFVELYKVTDEQYRICRV
FISNAYRGQGLSKSMLMLLIDKARLDFSATKLSLGVFEQNTVARKCYESLGFEVVMVVVIEFGGMRCQPLRRALCFLSRF
GAIIGLTFIDSRCDMNRKVEAYGVDAVERPKIKASKKLDLTGDAGRQIVKSETKLALRTHQKTFTKLADM
MNLEEFQESDFDLLIKWIDSDELNYLWGCPAYVFPLTYEQIHSHCSKAEVFPYLLKVKGRHAGFVELYKVTDEQYRICRV
FISNAYRGQGLSKSMLMLLIDKARLDFSATKLSLGVFEQNTVARKCYESLGFEVVMVVVIEFGGMRCQPLRRALCFLSRF
GAIIGLTFIDSRCDMNRKVEAYGVDAVERPKIKASKKLDLTGDAGRQIVKSETKLALRTHQKTFTKLADM
Download Length: 693 bp
Structures
Toxin
Loading, please wait
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0Q0PN34 |
Antitoxin
Loading, please wait
Source | ID | Structure |
---|---|---|
No matching records found |