Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | parDE/ParE-Phd |
Location | 365256..365834 | Replicon | chromosome |
Accession | NZ_CP006948 | ||
Organism | Vibrio cholerae O1 str. KW3 |
Toxin (Protein)
Gene name | parE | Uniprot ID | O68848 |
Locus tag | N900_RS15795 | Protein ID | WP_001180243.1 |
Coordinates | 365256..365573 (-) | Length | 106 a.a. |
Antitoxin (Protein)
Gene name | parD | Uniprot ID | Q7DCR7 |
Locus tag | N900_RS15800 | Protein ID | WP_000557292.1 |
Coordinates | 365592..365834 (-) | Length | 81 a.a. |
Genomic Context
Location: 360448..360843 (396 bp)
Type: Others
Protein ID: WP_000046952.1
Type: Others
Protein ID: WP_000046952.1
Location: 361146..361327 (182 bp)
Type: Others
Protein ID: Protein_347
Type: Others
Protein ID: Protein_347
Location: 361504..361899 (396 bp)
Type: Others
Protein ID: WP_000046953.1
Type: Others
Protein ID: WP_000046953.1
Location: 362043..362579 (537 bp)
Type: Others
Protein ID: WP_000644491.1
Type: Others
Protein ID: WP_000644491.1
Location: 362876..363055 (180 bp)
Type: Others
Protein ID: WP_001883039.1
Type: Others
Protein ID: WP_001883039.1
Location: 363251..363676 (426 bp)
Type: Others
Protein ID: WP_000403014.1
Type: Others
Protein ID: WP_000403014.1
Location: 363825..364172 (348 bp)
Type: Others
Protein ID: WP_000933409.1
Type: Others
Protein ID: WP_000933409.1
Location: 364319..364612 (294 bp)
Type: Others
Protein ID: WP_125460920.1
Type: Others
Protein ID: WP_125460920.1
Location: 364967..365062 (96 bp)
Type: Others
Protein ID: WP_001907607.1
Type: Others
Protein ID: WP_001907607.1
Location: 366076..366585 (510 bp)
Type: Others
Protein ID: WP_000405987.1
Type: Others
Protein ID: WP_000405987.1
Location: 366642..367295 (654 bp)
Type: Others
Protein ID: WP_000226874.1
Type: Others
Protein ID: WP_000226874.1
Location: 367605..367823 (219 bp)
Type: Others
Protein ID: WP_001917086.1
Type: Others
Protein ID: WP_001917086.1
Location: 368226..368459 (234 bp)
Type: Others
Protein ID: WP_032482776.1
Type: Others
Protein ID: WP_032482776.1
Location: 368884..369064 (181 bp)
Type: Others
Protein ID: Protein_361
Type: Others
Protein ID: Protein_361
Location: 369331..369618 (288 bp)
Type: Others
Protein ID: WP_001162670.1
Type: Others
Protein ID: WP_001162670.1
Location: 369629..369946 (318 bp)
Type: Others
Protein ID: WP_001232701.1
Type: Others
Protein ID: WP_001232701.1
Location: 369943..370053 (111 bp)
Type: Others
Protein ID: WP_134814058.1
Type: Others
Protein ID: WP_134814058.1
Location: 370230..370355 (126 bp)
Type: Others
Protein ID: WP_001944767.1
Type: Others
Protein ID: WP_001944767.1
Location: 370371..370409 (39 bp)
Type: Others
Protein ID: WP_106019119.1
Type: Others
Protein ID: WP_106019119.1
Location: 365256..365573 (318 bp)
Type: Toxin
Protein ID: WP_001180243.1
Type: Toxin
Protein ID: WP_001180243.1
Location: 365592..365834 (243 bp)
Type: Antitoxin
Protein ID: WP_000557292.1
Type: Antitoxin
Protein ID: WP_000557292.1
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N900_RS15760 | 360448..360843 | + | 396 | WP_000046952.1 | hypothetical protein | - |
N900_RS19550 | 361146..361327 | + | 182 | Protein_347 | DUF645 family protein | - |
N900_RS15765 | 361504..361899 | + | 396 | WP_000046953.1 | hypothetical protein | - |
N900_RS15770 | 362043..362579 | + | 537 | WP_000644491.1 | nucleotidyltransferase family protein | - |
N900_RS15780 | 362876..363055 | + | 180 | WP_001883039.1 | DUF645 family protein | - |
N900_RS15785 | 363251..363676 | + | 426 | WP_000403014.1 | GNAT family N-acetyltransferase | - |
N900_RS15790 | 363825..364172 | + | 348 | WP_000933409.1 | hypothetical protein | - |
N900_RS20185 | 364319..364612 | + | 294 | WP_125460920.1 | hypothetical protein | - |
N900_RS20350 | 364967..365062 | + | 96 | WP_001907607.1 | DUF645 family protein | - |
N900_RS15795 | 365256..365573 | - | 318 | WP_001180243.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
N900_RS15800 | 365592..365834 | - | 243 | WP_000557292.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
N900_RS15805 | 366076..366585 | + | 510 | WP_000405987.1 | GNAT family N-acetyltransferase | - |
N900_RS15810 | 366642..367295 | + | 654 | WP_000226874.1 | hypothetical protein | - |
N900_RS15815 | 367605..367823 | + | 219 | WP_001917086.1 | DUF3709 domain-containing protein | - |
N900_RS19580 | 368226..368459 | + | 234 | WP_032482776.1 | DUF3709 domain-containing protein | - |
N900_RS15820 | 368884..369064 | + | 181 | Protein_361 | DUF645 family protein | - |
N900_RS15825 | 369331..369618 | + | 288 | WP_001162670.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
N900_RS15830 | 369629..369946 | + | 318 | WP_001232701.1 | HigA family addiction module antidote protein | - |
N900_RS20355 | 369943..370053 | + | 111 | WP_134814058.1 | DUF3265 domain-containing protein | - |
N900_RS20360 | 370230..370355 | + | 126 | WP_001944767.1 | DUF645 family protein | - |
N900_RS20365 | 370371..370409 | + | 39 | WP_106019119.1 | hypothetical protein | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | catB9 | - | 304645..411088 | 106443 | |
inside | Integron | - | - | 309725..410760 | 101035 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 106 a.a. Molecular weight: 12158.97 Da Isoelectric Point: 9.7495
>T45808 WP_001180243.1 NZ_CP006948:c365573-365256 [Vibrio cholerae O1 str. KW3]
MQNKQYKLSQLAQEHLLKIKHYTIENFAEAQWQKYKSTLLSGFQTLADNPGLGKSCEDIYQNGFYFPVGKHMAYYTKEAN
FILIVAVLGQSQLPQKHLKQSRFVS
MQNKQYKLSQLAQEHLLKIKHYTIENFAEAQWQKYKSTLLSGFQTLADNPGLGKSCEDIYQNGFYFPVGKHMAYYTKEAN
FILIVAVLGQSQLPQKHLKQSRFVS
Download Length: 318 bp
>T45808 NZ_CP006948:c365573-365256 [Vibrio cholerae O1 str. KW3]
ATGCAAAATAAACAATATAAGCTCAGCCAATTAGCCCAAGAGCACTTACTCAAGATTAAACACTACACCATTGAAAATTT
CGCTGAAGCGCAGTGGCAAAAATATAAGTCGACCTTGCTTTCAGGTTTCCAAACTCTTGCGGATAACCCAGGACTAGGAA
AAAGCTGTGAAGATATTTACCAAAATGGTTTTTACTTTCCAGTGGGGAAACACATGGCTTATTACACCAAAGAAGCAAAC
TTCATTCTCATTGTTGCGGTATTAGGGCAATCACAACTGCCCCAAAAGCATCTCAAACAGTCACGCTTTGTTTCTTAG
ATGCAAAATAAACAATATAAGCTCAGCCAATTAGCCCAAGAGCACTTACTCAAGATTAAACACTACACCATTGAAAATTT
CGCTGAAGCGCAGTGGCAAAAATATAAGTCGACCTTGCTTTCAGGTTTCCAAACTCTTGCGGATAACCCAGGACTAGGAA
AAAGCTGTGAAGATATTTACCAAAATGGTTTTTACTTTCCAGTGGGGAAACACATGGCTTATTACACCAAAGAAGCAAAC
TTCATTCTCATTGTTGCGGTATTAGGGCAATCACAACTGCCCCAAAAGCATCTCAAACAGTCACGCTTTGTTTCTTAG
Antitoxin
Download Length: 81 a.a. Molecular weight: 8961.25 Da Isoelectric Point: 5.6630
>AT45808 WP_000557292.1 NZ_CP006948:c365834-365592 [Vibrio cholerae O1 str. KW3]
MHTLTANDAKRNFGELLLSAQREPVIISKNSKNTVVVMSIKDFEELEAMKLDYLKHCFESAQKDLDSGKTVDGATFLNTL
MHTLTANDAKRNFGELLLSAQREPVIISKNSKNTVVVMSIKDFEELEAMKLDYLKHCFESAQKDLDSGKTVDGATFLNTL
Download Length: 243 bp
>AT45808 NZ_CP006948:c365834-365592 [Vibrio cholerae O1 str. KW3]
ATGCACACACTAACAGCAAATGATGCTAAACGAAATTTTGGTGAACTTCTTCTAAGCGCACAACGCGAACCTGTCATCAT
CAGCAAAAACAGTAAGAATACTGTCGTTGTCATGTCCATTAAGGACTTTGAAGAACTTGAAGCAATGAAACTCGATTATC
TCAAACACTGCTTTGAGTCTGCTCAGAAAGACTTAGATAGTGGCAAAACCGTTGATGGTGCCACTTTTCTAAACACCCTT
TGA
ATGCACACACTAACAGCAAATGATGCTAAACGAAATTTTGGTGAACTTCTTCTAAGCGCACAACGCGAACCTGTCATCAT
CAGCAAAAACAGTAAGAATACTGTCGTTGTCATGTCCATTAAGGACTTTGAAGAACTTGAAGCAATGAAACTCGATTATC
TCAAACACTGCTTTGAGTCTGCTCAGAAAGACTTAGATAGTGGCAAAACCGTTGATGGTGCCACTTTTCTAAACACCCTT
TGA
Structures
Toxin
Loading, please wait
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0K9UJR8 |
Antitoxin
Loading, please wait
Source | ID | Structure |
---|---|---|
AlphaFold DB | Q7DCR7 |