Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | parDE/ParE-Phd |
Location | 90349..90927 | Replicon | chromosome |
Accession | NZ_CP026648 | ||
Organism | Vibrio cholerae O1 biovar El Tor strain HC1037 |
Toxin (Protein)
Gene name | parE | Uniprot ID | O68848 |
Locus tag | C4E16_RS14855 | Protein ID | WP_001180243.1 |
Coordinates | 90349..90666 (-) | Length | 106 a.a. |
Antitoxin (Protein)
Gene name | parD | Uniprot ID | Q7DCR7 |
Locus tag | C4E16_RS14860 | Protein ID | WP_000557292.1 |
Coordinates | 90685..90927 (-) | Length | 81 a.a. |
Genomic Context
Location: 85540..85935 (396 bp)
Type: Others
Protein ID: WP_000046952.1
Type: Others
Protein ID: WP_000046952.1
Location: 86238..86419 (182 bp)
Type: Others
Protein ID: Protein_125
Type: Others
Protein ID: Protein_125
Location: 86596..86991 (396 bp)
Type: Others
Protein ID: WP_000046953.1
Type: Others
Protein ID: WP_000046953.1
Location: 87135..87671 (537 bp)
Type: Others
Protein ID: WP_000644491.1
Type: Others
Protein ID: WP_000644491.1
Location: 87968..88147 (180 bp)
Type: Others
Protein ID: WP_001883039.1
Type: Others
Protein ID: WP_001883039.1
Location: 88343..88768 (426 bp)
Type: Others
Protein ID: WP_000403014.1
Type: Others
Protein ID: WP_000403014.1
Location: 88917..89264 (348 bp)
Type: Others
Protein ID: WP_000933409.1
Type: Others
Protein ID: WP_000933409.1
Location: 89411..89704 (294 bp)
Type: Others
Protein ID: WP_125460920.1
Type: Others
Protein ID: WP_125460920.1
Location: 90060..90155 (96 bp)
Type: Others
Protein ID: WP_001907607.1
Type: Others
Protein ID: WP_001907607.1
Location: 91169..91678 (510 bp)
Type: Others
Protein ID: WP_000405987.1
Type: Others
Protein ID: WP_000405987.1
Location: 91735..92388 (654 bp)
Type: Others
Protein ID: WP_000226874.1
Type: Others
Protein ID: WP_000226874.1
Location: 92698..92916 (219 bp)
Type: Others
Protein ID: WP_001917086.1
Type: Others
Protein ID: WP_001917086.1
Location: 93319..93552 (234 bp)
Type: Others
Protein ID: WP_032482776.1
Type: Others
Protein ID: WP_032482776.1
Location: 93977..94157 (181 bp)
Type: Others
Protein ID: Protein_139
Type: Others
Protein ID: Protein_139
Location: 94424..94711 (288 bp)
Type: Others
Protein ID: WP_001162670.1
Type: Others
Protein ID: WP_001162670.1
Location: 94722..95039 (318 bp)
Type: Others
Protein ID: WP_001232701.1
Type: Others
Protein ID: WP_001232701.1
Location: 95036..95146 (111 bp)
Type: Others
Protein ID: WP_134814058.1
Type: Others
Protein ID: WP_134814058.1
Location: 95323..95448 (126 bp)
Type: Others
Protein ID: WP_001944767.1
Type: Others
Protein ID: WP_001944767.1
Location: 95464..95502 (39 bp)
Type: Others
Protein ID: WP_106019119.1
Type: Others
Protein ID: WP_106019119.1
Location: 90349..90666 (318 bp)
Type: Toxin
Protein ID: WP_001180243.1
Type: Toxin
Protein ID: WP_001180243.1
Location: 90685..90927 (243 bp)
Type: Antitoxin
Protein ID: WP_000557292.1
Type: Antitoxin
Protein ID: WP_000557292.1
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
C4E16_RS14805 | 85540..85935 | + | 396 | WP_000046952.1 | hypothetical protein | - |
C4E16_RS14810 | 86238..86419 | + | 182 | Protein_125 | DUF645 family protein | - |
C4E16_RS14815 | 86596..86991 | + | 396 | WP_000046953.1 | hypothetical protein | - |
C4E16_RS14820 | 87135..87671 | + | 537 | WP_000644491.1 | nucleotidyltransferase family protein | - |
C4E16_RS14825 | 87968..88147 | + | 180 | WP_001883039.1 | DUF645 family protein | - |
C4E16_RS14830 | 88343..88768 | + | 426 | WP_000403014.1 | GNAT family N-acetyltransferase | - |
C4E16_RS14835 | 88917..89264 | + | 348 | WP_000933409.1 | hypothetical protein | - |
C4E16_RS19435 | 89411..89704 | + | 294 | WP_125460920.1 | hypothetical protein | - |
C4E16_RS19565 | 90060..90155 | + | 96 | WP_001907607.1 | DUF645 family protein | - |
C4E16_RS14855 | 90349..90666 | - | 318 | WP_001180243.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
C4E16_RS14860 | 90685..90927 | - | 243 | WP_000557292.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
C4E16_RS14865 | 91169..91678 | + | 510 | WP_000405987.1 | GNAT family N-acetyltransferase | - |
C4E16_RS14870 | 91735..92388 | + | 654 | WP_000226874.1 | hypothetical protein | - |
C4E16_RS14875 | 92698..92916 | + | 219 | WP_001917086.1 | DUF3709 domain-containing protein | - |
C4E16_RS14880 | 93319..93552 | + | 234 | WP_032482776.1 | DUF3709 domain-containing protein | - |
C4E16_RS14885 | 93977..94157 | + | 181 | Protein_139 | DUF645 family protein | - |
C4E16_RS14895 | 94424..94711 | + | 288 | WP_001162670.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
C4E16_RS14900 | 94722..95039 | + | 318 | WP_001232701.1 | HigA family addiction module antidote protein | - |
C4E16_RS19570 | 95036..95146 | + | 111 | WP_134814058.1 | DUF3265 domain-containing protein | - |
C4E16_RS14915 | 95323..95448 | + | 126 | WP_001944767.1 | DUF645 family protein | - |
C4E16_RS19440 | 95464..95502 | + | 39 | WP_106019119.1 | hypothetical protein | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | catB9 | - | 31043..136234 | 105191 | |
inside | Integron | - | - | 36123..135858 | 99735 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 106 a.a. Molecular weight: 12158.97 Da Isoelectric Point: 9.7495
>T95381 WP_001180243.1 NZ_CP026648:c90666-90349 [Vibrio cholerae O1 biovar El Tor]
MQNKQYKLSQLAQEHLLKIKHYTIENFAEAQWQKYKSTLLSGFQTLADNPGLGKSCEDIYQNGFYFPVGKHMAYYTKEAN
FILIVAVLGQSQLPQKHLKQSRFVS
MQNKQYKLSQLAQEHLLKIKHYTIENFAEAQWQKYKSTLLSGFQTLADNPGLGKSCEDIYQNGFYFPVGKHMAYYTKEAN
FILIVAVLGQSQLPQKHLKQSRFVS
Download Length: 318 bp
>T95381 NZ_CP026648:c90666-90349 [Vibrio cholerae O1 biovar El Tor]
ATGCAAAATAAACAATATAAGCTCAGCCAATTAGCCCAAGAGCACTTACTCAAGATTAAACACTACACCATTGAAAATTT
CGCTGAAGCGCAGTGGCAAAAATATAAGTCGACCTTGCTTTCAGGTTTCCAAACTCTTGCGGATAACCCAGGACTAGGAA
AAAGCTGTGAAGATATTTACCAAAATGGTTTTTACTTTCCAGTGGGGAAACACATGGCTTATTACACCAAAGAAGCAAAC
TTCATTCTCATTGTTGCGGTATTAGGGCAATCACAACTGCCCCAAAAGCATCTCAAACAGTCACGCTTTGTTTCTTAG
ATGCAAAATAAACAATATAAGCTCAGCCAATTAGCCCAAGAGCACTTACTCAAGATTAAACACTACACCATTGAAAATTT
CGCTGAAGCGCAGTGGCAAAAATATAAGTCGACCTTGCTTTCAGGTTTCCAAACTCTTGCGGATAACCCAGGACTAGGAA
AAAGCTGTGAAGATATTTACCAAAATGGTTTTTACTTTCCAGTGGGGAAACACATGGCTTATTACACCAAAGAAGCAAAC
TTCATTCTCATTGTTGCGGTATTAGGGCAATCACAACTGCCCCAAAAGCATCTCAAACAGTCACGCTTTGTTTCTTAG
Antitoxin
Download Length: 81 a.a. Molecular weight: 8961.25 Da Isoelectric Point: 5.6630
>AT95381 WP_000557292.1 NZ_CP026648:c90927-90685 [Vibrio cholerae O1 biovar El Tor]
MHTLTANDAKRNFGELLLSAQREPVIISKNSKNTVVVMSIKDFEELEAMKLDYLKHCFESAQKDLDSGKTVDGATFLNTL
MHTLTANDAKRNFGELLLSAQREPVIISKNSKNTVVVMSIKDFEELEAMKLDYLKHCFESAQKDLDSGKTVDGATFLNTL
Download Length: 243 bp
>AT95381 NZ_CP026648:c90927-90685 [Vibrio cholerae O1 biovar El Tor]
ATGCACACACTAACAGCAAATGATGCTAAACGAAATTTTGGTGAACTTCTTCTAAGCGCACAACGCGAACCTGTCATCAT
CAGCAAAAACAGTAAGAATACTGTCGTTGTCATGTCCATTAAGGACTTTGAAGAACTTGAAGCAATGAAACTCGATTATC
TCAAACACTGCTTTGAGTCTGCTCAGAAAGACTTAGATAGTGGCAAAACCGTTGATGGTGCCACTTTTCTAAACACCCTT
TGA
ATGCACACACTAACAGCAAATGATGCTAAACGAAATTTTGGTGAACTTCTTCTAAGCGCACAACGCGAACCTGTCATCAT
CAGCAAAAACAGTAAGAATACTGTCGTTGTCATGTCCATTAAGGACTTTGAAGAACTTGAAGCAATGAAACTCGATTATC
TCAAACACTGCTTTGAGTCTGCTCAGAAAGACTTAGATAGTGGCAAAACCGTTGATGGTGCCACTTTTCTAAACACCCTT
TGA
Structures
Toxin
Loading, please wait
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0K9UJR8 |
Antitoxin
Loading, please wait
Source | ID | Structure |
---|---|---|
AlphaFold DB | Q7DCR7 |