Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | /GNAT-DUF1778 |
Location | 421785..422551 | Replicon | chromosome |
Accession | NZ_LT906615 | ||
Organism | Vibrio cholerae O1 biovar El Tor str. N16961 |
Toxin (Protein)
Gene name | - | Uniprot ID | Q9K2P7 |
Locus tag | FY484_RS16440 | Protein ID | WP_000982260.1 |
Coordinates | 421785..422282 (-) | Length | 166 a.a. |
Antitoxin (Protein)
Gene name | - | Uniprot ID | Q9K2J6 |
Locus tag | FY484_RS16445 | Protein ID | WP_000246253.1 |
Coordinates | 422279..422551 (-) | Length | 91 a.a. |
Genomic Context
Location: 417647..417953 (307 bp)
Type: Others
Protein ID: Protein_446
Type: Others
Protein ID: Protein_446
Location: 418090..418782 (693 bp)
Type: Others
Protein ID: WP_001047169.1
Type: Others
Protein ID: WP_001047169.1
Location: 418782..419183 (402 bp)
Type: Others
Protein ID: WP_000351248.1
Type: Others
Protein ID: WP_000351248.1
Location: 419153..419296 (144 bp)
Type: Others
Protein ID: WP_071908341.1
Type: Others
Protein ID: WP_071908341.1
Location: 419371..419784 (414 bp)
Type: Others
Protein ID: WP_000049417.1
Type: Others
Protein ID: WP_000049417.1
Location: 419998..420249 (252 bp)
Type: Others
Protein ID: WP_001250179.1
Type: Others
Protein ID: WP_001250179.1
Location: 420239..420526 (288 bp)
Type: Others
Protein ID: WP_000221354.1
Type: Others
Protein ID: WP_000221354.1
Location: 420654..421109 (456 bp)
Type: Others
Protein ID: WP_001245327.1
Type: Others
Protein ID: WP_001245327.1
Location: 421431..421583 (153 bp)
Type: Others
Protein ID: WP_001884520.1
Type: Others
Protein ID: WP_001884520.1
Location: 422782..423450 (669 bp)
Type: Others
Protein ID: WP_000043871.1
Type: Others
Protein ID: WP_000043871.1
Location: 423602..423889 (288 bp)
Type: Others
Protein ID: WP_000426470.1
Type: Others
Protein ID: WP_000426470.1
Location: 424030..424401 (372 bp)
Type: Others
Protein ID: WP_001164080.1
Type: Others
Protein ID: WP_001164080.1
Location: 424468..424893 (426 bp)
Type: Others
Protein ID: WP_001882332.1
Type: Others
Protein ID: WP_001882332.1
Location: 424890..425423 (534 bp)
Type: Others
Protein ID: WP_000118351.1
Type: Others
Protein ID: WP_000118351.1
Location: 425625..425882 (258 bp)
Type: Others
Protein ID: WP_000861987.1
Type: Others
Protein ID: WP_000861987.1
Location: 425870..426172 (303 bp)
Type: Others
Protein ID: WP_000229317.1
Type: Others
Protein ID: WP_000229317.1
Location: 426406..427323 (918 bp)
Type: Others
Protein ID: WP_000186333.1
Type: Others
Protein ID: WP_000186333.1
Location: 421785..422282 (498 bp)
Type: Toxin
Protein ID: WP_000982260.1
Type: Toxin
Protein ID: WP_000982260.1
Location: 422279..422551 (273 bp)
Type: Antitoxin
Protein ID: WP_000246253.1
Type: Antitoxin
Protein ID: WP_000246253.1
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
FY484_RS16390 | 417647..417953 | + | 307 | Protein_446 | CatB-related O-acetyltransferase | - |
FY484_RS16395 | 418090..418782 | + | 693 | WP_001047169.1 | GNAT family N-acetyltransferase | - |
FY484_RS16400 | 418782..419183 | + | 402 | WP_000351248.1 | type II toxin-antitoxin system death-on-curing family toxin | - |
FY484_RS16405 | 419153..419296 | + | 144 | WP_071908341.1 | DUF3265 domain-containing protein | - |
FY484_RS16410 | 419371..419784 | + | 414 | WP_000049417.1 | VOC family protein | - |
FY484_RS16415 | 419998..420249 | + | 252 | WP_001250179.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | - |
FY484_RS16420 | 420239..420526 | + | 288 | WP_000221354.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
FY484_RS16425 | 420654..421109 | + | 456 | WP_001245327.1 | GNAT family N-acetyltransferase | - |
FY484_RS16430 | 421431..421583 | + | 153 | WP_001884520.1 | DUF645 family protein | - |
FY484_RS16440 | 421785..422282 | - | 498 | WP_000982260.1 | GNAT family N-acetyltransferase | Toxin |
FY484_RS16445 | 422279..422551 | - | 273 | WP_000246253.1 | DUF1778 domain-containing protein | Antitoxin |
FY484_RS16450 | 422782..423450 | + | 669 | WP_000043871.1 | hypothetical protein | - |
FY484_RS16455 | 423602..423889 | + | 288 | WP_000426470.1 | hypothetical protein | - |
FY484_RS16460 | 424030..424401 | + | 372 | WP_001164080.1 | nucleotide pyrophosphohydrolase | - |
FY484_RS19570 | 424468..424893 | + | 426 | WP_001882332.1 | DUF1778 domain-containing protein | - |
FY484_RS16470 | 424890..425423 | + | 534 | WP_000118351.1 | GNAT family N-acetyltransferase | - |
FY484_RS16480 | 425625..425882 | + | 258 | WP_000861987.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | - |
FY484_RS16485 | 425870..426172 | + | 303 | WP_000229317.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
FY484_RS16490 | 426406..427323 | + | 918 | WP_000186333.1 | alpha/beta hydrolase | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
flank | IS/Tn | - | - | 416599..417579 | 980 | ||
- | inside | Genomic island | catB9 | - | 304666..435761 | 131095 | |
inside | Integron | catB9 | - | 309746..435385 | 125639 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 166 a.a. Molecular weight: 18527.18 Da Isoelectric Point: 8.7753
>T293804 WP_000982260.1 NZ_LT906615:c422282-421785 [Vibrio cholerae O1 biovar El Tor str. N16961]
MMNTVLLDKDKHDRNRFNCGTEALNNYLKVMASQQAKKDNTRTFVLEDDNNSAYIIGFYTLTMTPIDLKALPDKLQKKHQ
SSTSGGLIARLAVDDRYKGKGFGEWLLIDALRKLLAASDSVAFPVVIVDAKDGAKHFYERYGFQAFQDAENKLFITIADI
RASLG
MMNTVLLDKDKHDRNRFNCGTEALNNYLKVMASQQAKKDNTRTFVLEDDNNSAYIIGFYTLTMTPIDLKALPDKLQKKHQ
SSTSGGLIARLAVDDRYKGKGFGEWLLIDALRKLLAASDSVAFPVVIVDAKDGAKHFYERYGFQAFQDAENKLFITIADI
RASLG
Download Length: 498 bp
Antitoxin
Structures
Toxin
Loading, please wait
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0Q0KGB1 |
Antitoxin
Loading, please wait
Source | ID | Structure |
---|---|---|
PDB | 1Y9B | |
AlphaFold DB | A0A0F2IC79 |