Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | relBE/YafQ-RelB |
Location | 1033164..1033704 | Replicon | chromosome |
Accession | NC_012667 | ||
Organism | Vibrio cholerae MJ-1236 |
Toxin (Protein)
Gene name | relE | Uniprot ID | A0A151JGK8 |
Locus tag | VCD_RS19485 | Protein ID | WP_000277238.1 |
Coordinates | 1033435..1033704 (+) | Length | 90 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | Q9KML3 |
Locus tag | VCD_RS19480 | Protein ID | WP_001258569.1 |
Coordinates | 1033164..1033442 (+) | Length | 93 a.a. |
Genomic Context
Location: 1033164..1033442 (279 bp)
Type: Antitoxin
Protein ID: WP_001258569.1
Type: Antitoxin
Protein ID: WP_001258569.1
Location: 1033435..1033704 (270 bp)
Type: Toxin
Protein ID: WP_000277238.1
Type: Toxin
Protein ID: WP_000277238.1
Location: 1035066..1035338 (273 bp)
Type: Others
Protein ID: WP_000246253.1
Type: Others
Protein ID: WP_000246253.1
Location: 1035335..1035832 (498 bp)
Type: Others
Protein ID: WP_000982260.1
Type: Others
Protein ID: WP_000982260.1
Location: 1038458..1038700 (243 bp)
Type: Others
Protein ID: WP_000557292.1
Type: Others
Protein ID: WP_000557292.1
Location: 1028744..1029211 (468 bp)
Type: Others
Protein ID: WP_001289288.1
Type: Others
Protein ID: WP_001289288.1
Location: 1029423..1029461 (39 bp)
Type: Others
Protein ID: WP_082798268.1
Type: Others
Protein ID: WP_082798268.1
Location: 1029515..1029658 (144 bp)
Type: Others
Protein ID: Protein_956
Type: Others
Protein ID: Protein_956
Location: 1030033..1030311 (279 bp)
Type: Others
Protein ID: WP_000280324.1
Type: Others
Protein ID: WP_000280324.1
Location: 1030563..1030805 (243 bp)
Type: Others
Protein ID: WP_000107461.1
Type: Others
Protein ID: WP_000107461.1
Location: 1030897..1031046 (150 bp)
Type: Others
Protein ID: WP_071908333.1
Type: Others
Protein ID: WP_071908333.1
Location: 1031019..1031270 (252 bp)
Type: Others
Protein ID: WP_001890111.1
Type: Others
Protein ID: WP_001890111.1
Location: 1031465..1031851 (387 bp)
Type: Others
Protein ID: WP_000703163.1
Type: Others
Protein ID: WP_000703163.1
Location: 1031841..1031942 (102 bp)
Type: Others
Protein ID: WP_001921603.1
Type: Others
Protein ID: WP_001921603.1
Location: 1032142..1032348 (207 bp)
Type: Others
Protein ID: Protein_963
Type: Others
Protein ID: Protein_963
Location: 1032600..1032878 (279 bp)
Type: Others
Protein ID: WP_001921601.1
Type: Others
Protein ID: WP_001921601.1
Location: 1033852..1034298 (447 bp)
Type: Others
Protein ID: WP_000006157.1
Type: Others
Protein ID: WP_000006157.1
Location: 1034494..1034532 (39 bp)
Type: Others
Protein ID: WP_106019118.1
Type: Others
Protein ID: WP_106019118.1
Location: 1034548..1034673 (126 bp)
Type: Others
Protein ID: WP_001900195.1
Type: Others
Protein ID: WP_001900195.1
Location: 1035982..1036497 (516 bp)
Type: Others
Protein ID: WP_001201509.1
Type: Others
Protein ID: WP_001201509.1
Location: 1036634..1037170 (537 bp)
Type: Others
Protein ID: WP_000469482.1
Type: Others
Protein ID: WP_000469482.1
Location: 1037428..1037709 (282 bp)
Type: Others
Protein ID: WP_001894429.1
Type: Others
Protein ID: WP_001894429.1
Location: 1037658..1037771 (114 bp)
Type: Others
Protein ID: WP_001900214.1
Type: Others
Protein ID: WP_001900214.1
Location: 1037828..1038214 (387 bp)
Type: Others
Protein ID: WP_001015867.1
Type: Others
Protein ID: WP_001015867.1
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
VCD_RS19445 | 1028744..1029211 | - | 468 | WP_001289288.1 | OsmC family protein | - |
VCD_RS21090 | 1029423..1029461 | - | 39 | WP_082798268.1 | hypothetical protein | - |
VCD_RS21095 | 1029515..1029658 | - | 144 | Protein_956 | DUF645 family protein | - |
VCD_RS19455 | 1030033..1030311 | - | 279 | WP_000280324.1 | DUF3709 domain-containing protein | - |
VCD_RS19460 | 1030563..1030805 | - | 243 | WP_000107461.1 | hypothetical protein | - |
VCD_RS20550 | 1030897..1031046 | - | 150 | WP_071908333.1 | DUF3265 domain-containing protein | - |
VCD_RS19465 | 1031019..1031270 | - | 252 | WP_001890111.1 | TIGR03643 family protein | - |
VCD_RS19470 | 1031465..1031851 | - | 387 | WP_000703163.1 | VOC family protein | - |
VCD_RS20935 | 1031841..1031942 | - | 102 | WP_001921603.1 | hypothetical protein | - |
VCD_RS20940 | 1032142..1032348 | - | 207 | Protein_963 | DUF3709 domain-containing protein | - |
VCD_RS20560 | 1032600..1032878 | - | 279 | WP_001921601.1 | DUF3709 domain-containing protein | - |
VCD_RS19480 | 1033164..1033442 | + | 279 | WP_001258569.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
VCD_RS19485 | 1033435..1033704 | + | 270 | WP_000277238.1 | type II toxin-antitoxin system YafQ family toxin | Toxin |
VCD_RS19490 | 1033852..1034298 | - | 447 | WP_000006157.1 | hypothetical protein | - |
VCD_RS20945 | 1034494..1034532 | - | 39 | WP_106019118.1 | hypothetical protein | - |
VCD_RS20795 | 1034548..1034673 | - | 126 | WP_001900195.1 | DUF645 family protein | - |
VCD_RS19500 | 1035066..1035338 | + | 273 | WP_000246253.1 | DUF1778 domain-containing protein | - |
VCD_RS19505 | 1035335..1035832 | + | 498 | WP_000982260.1 | GNAT family N-acetyltransferase | - |
VCD_RS19510 | 1035982..1036497 | - | 516 | WP_001201509.1 | lipocalin family protein | - |
VCD_RS19515 | 1036634..1037170 | - | 537 | WP_000469482.1 | GNAT family N-acetyltransferase | - |
VCD_RS19525 | 1037428..1037709 | - | 282 | WP_001894429.1 | DUF1289 domain-containing protein | - |
VCD_RS20575 | 1037658..1037771 | - | 114 | WP_001900214.1 | hypothetical protein | - |
VCD_RS19530 | 1037828..1038214 | - | 387 | WP_001015867.1 | NUDIX hydrolase | - |
VCD_RS19535 | 1038458..1038700 | + | 243 | WP_000557292.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | catB9 | - | 932253..1057432 | 125179 | |
inside | Integron | - | - | 958376..1050596 | 92220 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 90 a.a. Molecular weight: 10406.11 Da Isoelectric Point: 9.5084
>T23793 WP_000277238.1 NC_012667:1033435-1033704 [Vibrio cholerae MJ-1236]
MYKLEYSTQFKKDFKKITKMPISDIIEVGNVISKLQRGEKLEPKNVDHPLTGNWVGFRDCHIKPDLVLIYRVFNDQLQLA
RIGSHSDLF
MYKLEYSTQFKKDFKKITKMPISDIIEVGNVISKLQRGEKLEPKNVDHPLTGNWVGFRDCHIKPDLVLIYRVFNDQLQLA
RIGSHSDLF
Download Length: 270 bp
>T23793 NC_012667:1033435-1033704 [Vibrio cholerae MJ-1236]
ATGTATAAACTCGAATACTCCACACAGTTTAAGAAAGATTTCAAAAAGATAACTAAGATGCCGATTTCAGACATCATTGA
AGTCGGCAATGTTATTTCTAAGCTGCAACGCGGCGAAAAGCTTGAACCCAAGAATGTTGACCATCCGTTAACTGGAAATT
GGGTTGGATTTCGAGACTGCCACATTAAACCCGACCTAGTGTTAATCTATCGAGTTTTTAACGATCAACTACAACTAGCG
CGCATTGGTTCACATAGTGATTTATTCTAA
ATGTATAAACTCGAATACTCCACACAGTTTAAGAAAGATTTCAAAAAGATAACTAAGATGCCGATTTCAGACATCATTGA
AGTCGGCAATGTTATTTCTAAGCTGCAACGCGGCGAAAAGCTTGAACCCAAGAATGTTGACCATCCGTTAACTGGAAATT
GGGTTGGATTTCGAGACTGCCACATTAAACCCGACCTAGTGTTAATCTATCGAGTTTTTAACGATCAACTACAACTAGCG
CGCATTGGTTCACATAGTGATTTATTCTAA
Antitoxin
Download Length: 93 a.a. Molecular weight: 10088.58 Da Isoelectric Point: 6.0728
>AT23793 WP_001258569.1 NC_012667:1033164-1033442 [Vibrio cholerae MJ-1236]
MRTEMLSTRIDHDTKIAFTNVCDEMGLSTSQAIKLFAKAVINHGGIPFELRVPQPNEVTASAIQELVEGKGHKAESVEAM
LNELTEGKVKHV
MRTEMLSTRIDHDTKIAFTNVCDEMGLSTSQAIKLFAKAVINHGGIPFELRVPQPNEVTASAIQELVEGKGHKAESVEAM
LNELTEGKVKHV
Download Length: 279 bp
>AT23793 NC_012667:1033164-1033442 [Vibrio cholerae MJ-1236]
ATGAGAACAGAAATGCTGAGCACGCGCATTGACCACGACACGAAAATTGCGTTCACAAACGTCTGCGATGAGATGGGTCT
AAGTACATCACAGGCCATAAAGTTATTTGCAAAAGCGGTTATTAATCATGGTGGAATCCCTTTTGAGCTGCGAGTTCCAC
AGCCTAATGAGGTTACTGCATCTGCAATTCAAGAGCTCGTTGAAGGAAAAGGACATAAAGCTGAATCCGTTGAAGCTATG
CTGAATGAGCTTACTGAAGGCAAAGTTAAGCATGTATAA
ATGAGAACAGAAATGCTGAGCACGCGCATTGACCACGACACGAAAATTGCGTTCACAAACGTCTGCGATGAGATGGGTCT
AAGTACATCACAGGCCATAAAGTTATTTGCAAAAGCGGTTATTAATCATGGTGGAATCCCTTTTGAGCTGCGAGTTCCAC
AGCCTAATGAGGTTACTGCATCTGCAATTCAAGAGCTCGTTGAAGGAAAAGGACATAAAGCTGAATCCGTTGAAGCTATG
CTGAATGAGCTTACTGAAGGCAAAGTTAAGCATGTATAA
Structures
Toxin
Loading, please wait
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A151JGK8 |
Antitoxin
Loading, please wait
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A151KTP9 |