Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | /BrnT(toxin) |
Location | 388911..389409 | Replicon | chromosome |
Accession | NZ_CP046841 | ||
Organism | Vibrio cholerae strain F9993 |
Toxin (Protein)
Gene name | - | Uniprot ID | Q9KMK7 |
Locus tag | GPY07_RS16355 | Protein ID | WP_000589156.1 |
Coordinates | 389143..389409 (-) | Length | 89 a.a. |
Antitoxin (Protein)
Gene name | - | Uniprot ID | Q9KMK6 |
Locus tag | GPY07_RS16350 | Protein ID | WP_000643598.1 |
Coordinates | 388911..389156 (-) | Length | 82 a.a. |
Genomic Context
Location: 384401..384580 (180 bp)
Type: Others
Protein ID: WP_001883058.1
Type: Others
Protein ID: WP_001883058.1
Location: 385158..385268 (111 bp)
Type: Others
Protein ID: WP_079857360.1
Type: Others
Protein ID: WP_079857360.1
Location: 385278..385976 (699 bp)
Type: Others
Protein ID: WP_001890502.1
Type: Others
Protein ID: WP_001890502.1
Location: 386099..386725 (627 bp)
Type: Others
Protein ID: WP_000365424.1
Type: Others
Protein ID: WP_000365424.1
Location: 386767..386859 (93 bp)
Type: Others
Protein ID: WP_014378730.1
Type: Others
Protein ID: WP_014378730.1
Location: 386874..387347 (474 bp)
Type: Others
Protein ID: WP_001161076.1
Type: Others
Protein ID: WP_001161076.1
Location: 387547..387729 (183 bp)
Type: Others
Protein ID: WP_000923182.1
Type: Others
Protein ID: WP_000923182.1
Location: 387790..387918 (129 bp)
Type: Others
Protein ID: WP_071908338.1
Type: Others
Protein ID: WP_071908338.1
Location: 388021..388815 (795 bp)
Type: Others
Protein ID: WP_001911581.1
Type: Others
Protein ID: WP_001911581.1
Location: 388911..389156 (246 bp)
Type: Antitoxin
Protein ID: WP_000643598.1
Type: Antitoxin
Protein ID: WP_000643598.1
Location: 389143..389409 (267 bp)
Type: Toxin
Protein ID: WP_000589156.1
Type: Toxin
Protein ID: WP_000589156.1
Location: 389594..390256 (663 bp)
Type: Others
Protein ID: WP_000960654.1
Type: Others
Protein ID: WP_000960654.1
Location: 390384..390851 (468 bp)
Type: Others
Protein ID: WP_001289288.1
Type: Others
Protein ID: WP_001289288.1
Location: 391063..391101 (39 bp)
Type: Others
Protein ID: WP_082798268.1
Type: Others
Protein ID: WP_082798268.1
Location: 391155..391298 (144 bp)
Type: Others
Protein ID: Protein_400
Type: Others
Protein ID: Protein_400
Location: 391673..391951 (279 bp)
Type: Others
Protein ID: WP_000280324.1
Type: Others
Protein ID: WP_000280324.1
Location: 392203..392445 (243 bp)
Type: Others
Protein ID: WP_000107461.1
Type: Others
Protein ID: WP_000107461.1
Location: 392537..392686 (150 bp)
Type: Others
Protein ID: WP_071908333.1
Type: Others
Protein ID: WP_071908333.1
Location: 392659..392910 (252 bp)
Type: Others
Protein ID: WP_001890111.1
Type: Others
Protein ID: WP_001890111.1
Location: 393105..393491 (387 bp)
Type: Others
Protein ID: WP_000703163.1
Type: Others
Protein ID: WP_000703163.1
Location: 393481..393582 (102 bp)
Type: Others
Protein ID: WP_001921603.1
Type: Others
Protein ID: WP_001921603.1
Location: 393782..393988 (207 bp)
Type: Others
Protein ID: Protein_407
Type: Others
Protein ID: Protein_407
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
GPY07_RS16305 | 384401..384580 | - | 180 | WP_001883058.1 | DUF645 family protein | - |
GPY07_RS16315 | 385158..385268 | - | 111 | WP_079857360.1 | DUF3265 domain-containing protein | - |
GPY07_RS16320 | 385278..385976 | - | 699 | WP_001890502.1 | hypothetical protein | - |
GPY07_RS16325 | 386099..386725 | - | 627 | WP_000365424.1 | LysE family translocator | - |
GPY07_RS16330 | 386767..386859 | - | 93 | WP_014378730.1 | DUF3265 domain-containing protein | - |
GPY07_RS16335 | 386874..387347 | - | 474 | WP_001161076.1 | GrpB family protein | - |
GPY07_RS16340 | 387547..387729 | - | 183 | WP_000923182.1 | DUF645 family protein | - |
GPY07_RS19455 | 387790..387918 | - | 129 | WP_071908338.1 | general secretion pathway protein GspI | - |
GPY07_RS16345 | 388021..388815 | - | 795 | WP_001911581.1 | hypothetical protein | - |
GPY07_RS16350 | 388911..389156 | - | 246 | WP_000643598.1 | hypothetical protein | Antitoxin |
GPY07_RS16355 | 389143..389409 | - | 267 | WP_000589156.1 | BrnT family toxin | Toxin |
GPY07_RS16360 | 389594..390256 | - | 663 | WP_000960654.1 | hypothetical protein | - |
GPY07_RS16365 | 390384..390851 | - | 468 | WP_001289288.1 | OsmC family protein | - |
GPY07_RS19460 | 391063..391101 | - | 39 | WP_082798268.1 | hypothetical protein | - |
GPY07_RS19465 | 391155..391298 | - | 144 | Protein_400 | DUF645 family protein | - |
GPY07_RS16375 | 391673..391951 | - | 279 | WP_000280324.1 | DUF3709 domain-containing protein | - |
GPY07_RS16380 | 392203..392445 | - | 243 | WP_000107461.1 | hypothetical protein | - |
GPY07_RS16385 | 392537..392686 | - | 150 | WP_071908333.1 | DUF3265 domain-containing protein | - |
GPY07_RS16390 | 392659..392910 | - | 252 | WP_001890111.1 | TIGR03643 family protein | - |
GPY07_RS16395 | 393105..393491 | - | 387 | WP_000703163.1 | VOC family protein | - |
GPY07_RS16400 | 393481..393582 | - | 102 | WP_001921603.1 | hypothetical protein | - |
GPY07_RS16405 | 393782..393988 | - | 207 | Protein_407 | DUF3709 domain-containing protein | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | catB9 | - | 322056..419024 | 96968 | |
inside | Integron | - | - | 322432..412236 | 89804 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 89 a.a. Molecular weight: 10092.34 Da Isoelectric Point: 7.3171
>T145069 WP_000589156.1 NZ_CP046841:c389409-389143 [Vibrio cholerae]
MIKFEFDENKSRSNLEKHGIDFHTAQGLWNDSDLIEIPANTSDEPRYLVVGLLNGKHWSGVITYRGTNIRIISVRRSRKA
EVSLYESA
MIKFEFDENKSRSNLEKHGIDFHTAQGLWNDSDLIEIPANTSDEPRYLVVGLLNGKHWSGVITYRGTNIRIISVRRSRKA
EVSLYESA
Download Length: 267 bp
>T145069 NZ_CP062253:c2324049-2323765 [Pseudomonas gozinkensis]
ATGCAGATTAAGTGGCGACCCAAGGCTCGGGTCGAACTCTCGAAAATACTGAAGTACATTGGCGAGCGAAATTTTGTGGC
GGCGACAGCACTTCACAAGCCAGTCGTAAAAACTACATCTGCGCTTCCTTGGCATCCACACCTGTATCGCAAAGGTCGCT
CTCCCGGCACTCGGGAGATTGTGGTTAGCCCGAACTATCTCGTCGTTTATCAAGTGGCGGACCGAATTGAGATTGTGAGC
ATCTTGCATGCGCGTCAGGAATACCCTCGACGCGACCCCAGTTAA
ATGCAGATTAAGTGGCGACCCAAGGCTCGGGTCGAACTCTCGAAAATACTGAAGTACATTGGCGAGCGAAATTTTGTGGC
GGCGACAGCACTTCACAAGCCAGTCGTAAAAACTACATCTGCGCTTCCTTGGCATCCACACCTGTATCGCAAAGGTCGCT
CTCCCGGCACTCGGGAGATTGTGGTTAGCCCGAACTATCTCGTCGTTTATCAAGTGGCGGACCGAATTGAGATTGTGAGC
ATCTTGCATGCGCGTCAGGAATACCCTCGACGCGACCCCAGTTAA
Antitoxin
Download Length: 82 a.a. Molecular weight: 9478.77 Da Isoelectric Point: 6.4832
>AT145069 WP_000643598.1 NZ_CP046841:c389156-388911 [Vibrio cholerae]
MKAHEFDAKFESDDDDIVMDLDLSQAKRPMHKQKRVNVDFPAWMLESLDREASRIGVTRQSIIKIWLAERLESVSHHSSV
R
MKAHEFDAKFESDDDDIVMDLDLSQAKRPMHKQKRVNVDFPAWMLESLDREASRIGVTRQSIIKIWLAERLESVSHHSSV
R
Download Length: 246 bp
>AT145069 NZ_CP062253:c2324245-2324039 [Pseudomonas gozinkensis]
ATGATCGACCCGTCTTTGATCGACCCACTGTGCCCGGTTGTTTCGGATCTTGCTCCTGAGGAGCAGGCTGCGAGTTATGA
CCGTTGGTTTCGCGCCGAAGTACAGGCCTCTCTCGATGATCCGCGTCCGAGTATTCCCCATGAGCAAGTGATAGCGGAAA
TAAACGCCTTGATGGAATCAATGCGCAAAAGCGCTGATGCAGATTAA
ATGATCGACCCGTCTTTGATCGACCCACTGTGCCCGGTTGTTTCGGATCTTGCTCCTGAGGAGCAGGCTGCGAGTTATGA
CCGTTGGTTTCGCGCCGAAGTACAGGCCTCTCTCGATGATCCGCGTCCGAGTATTCCCCATGAGCAAGTGATAGCGGAAA
TAAACGCCTTGATGGAATCAATGCGCAAAAGCGCTGATGCAGATTAA
Structures
Toxin
Loading, please wait
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A271VMP7 |
Antitoxin
Loading, please wait
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A271VME2 |