Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | relBE/ParE-YafN |
Location | 395375..395903 | Replicon | chromosome |
Accession | NZ_CP006948 | ||
Organism | Vibrio cholerae O1 str. KW3 |
Toxin (Protein)
Gene name | relE | Uniprot ID | A0A0X1KZS6 |
Locus tag | N900_RS16030 | Protein ID | WP_000221354.1 |
Coordinates | 395616..395903 (+) | Length | 96 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | A0A0X1KZS8 |
Locus tag | N900_RS16025 | Protein ID | WP_001250179.1 |
Coordinates | 395375..395626 (+) | Length | 84 a.a. |
Genomic Context
Location: 390643..390957 (315 bp)
Type: Others
Protein ID: WP_000071008.1
Type: Others
Protein ID: WP_000071008.1
Location: 391094..391528 (435 bp)
Type: Others
Protein ID: WP_000256036.1
Type: Others
Protein ID: WP_000256036.1
Location: 391696..391851 (156 bp)
Type: Others
Protein ID: WP_000751734.1
Type: Others
Protein ID: WP_000751734.1
Location: 393024..393296 (273 bp)
Type: Others
Protein ID: Protein_403
Type: Others
Protein ID: Protein_403
Location: 393467..394159 (693 bp)
Type: Others
Protein ID: WP_001047169.1
Type: Others
Protein ID: WP_001047169.1
Location: 394159..394560 (402 bp)
Type: Others
Protein ID: WP_000351248.1
Type: Others
Protein ID: WP_000351248.1
Location: 394530..394673 (144 bp)
Type: Others
Protein ID: WP_071908341.1
Type: Others
Protein ID: WP_071908341.1
Location: 394748..395161 (414 bp)
Type: Others
Protein ID: WP_000049417.1
Type: Others
Protein ID: WP_000049417.1
Location: 395375..395626 (252 bp)
Type: Antitoxin
Protein ID: WP_001250179.1
Type: Antitoxin
Protein ID: WP_001250179.1
Location: 395616..395903 (288 bp)
Type: Toxin
Protein ID: WP_000221354.1
Type: Toxin
Protein ID: WP_000221354.1
Location: 396031..396486 (456 bp)
Type: Others
Protein ID: WP_001245327.1
Type: Others
Protein ID: WP_001245327.1
Location: 396808..396960 (153 bp)
Type: Others
Protein ID: WP_001884520.1
Type: Others
Protein ID: WP_001884520.1
Location: 398159..398827 (669 bp)
Type: Others
Protein ID: WP_000043871.1
Type: Others
Protein ID: WP_000043871.1
Location: 398979..399266 (288 bp)
Type: Others
Protein ID: WP_000426470.1
Type: Others
Protein ID: WP_000426470.1
Location: 399407..399778 (372 bp)
Type: Others
Protein ID: WP_001164080.1
Type: Others
Protein ID: WP_001164080.1
Location: 399845..400270 (426 bp)
Type: Others
Protein ID: WP_001882332.1
Type: Others
Protein ID: WP_001882332.1
Location: 400267..400800 (534 bp)
Type: Others
Protein ID: WP_000118351.1
Type: Others
Protein ID: WP_000118351.1
Location: 391976..392956 (981 bp)
Type: Others
Protein ID: WP_000019370.1
Type: Others
Protein ID: WP_000019370.1
Location: 397162..397659 (498 bp)
Type: Others
Protein ID: WP_000982260.1
Type: Others
Protein ID: WP_000982260.1
Location: 397656..397928 (273 bp)
Type: Others
Protein ID: WP_000246253.1
Type: Others
Protein ID: WP_000246253.1
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N900_RS15985 | 390643..390957 | + | 315 | WP_000071008.1 | DNA-binding transcriptional regulator | - |
N900_RS15990 | 391094..391528 | + | 435 | WP_000256036.1 | GNAT family N-acetyltransferase | - |
N900_RS20190 | 391696..391851 | + | 156 | WP_000751734.1 | hypothetical protein | - |
N900_RS16000 | 391976..392956 | - | 981 | WP_000019370.1 | IS5-like element ISVch5 family transposase | - |
N900_RS16005 | 393024..393296 | + | 273 | Protein_403 | CatB-related O-acetyltransferase | - |
N900_RS16010 | 393467..394159 | + | 693 | WP_001047169.1 | GNAT family N-acetyltransferase | - |
N900_RS16015 | 394159..394560 | + | 402 | WP_000351248.1 | type II toxin-antitoxin system death-on-curing family toxin | - |
N900_RS20050 | 394530..394673 | + | 144 | WP_071908341.1 | DUF3265 domain-containing protein | - |
N900_RS16020 | 394748..395161 | + | 414 | WP_000049417.1 | VOC family protein | - |
N900_RS16025 | 395375..395626 | + | 252 | WP_001250179.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
N900_RS16030 | 395616..395903 | + | 288 | WP_000221354.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
N900_RS16035 | 396031..396486 | + | 456 | WP_001245327.1 | GNAT family N-acetyltransferase | - |
N900_RS16040 | 396808..396960 | + | 153 | WP_001884520.1 | DUF645 family protein | - |
N900_RS16045 | 397162..397659 | - | 498 | WP_000982260.1 | GNAT family N-acetyltransferase | - |
N900_RS16050 | 397656..397928 | - | 273 | WP_000246253.1 | DUF1778 domain-containing protein | - |
N900_RS16055 | 398159..398827 | + | 669 | WP_000043871.1 | hypothetical protein | - |
N900_RS16060 | 398979..399266 | + | 288 | WP_000426470.1 | hypothetical protein | - |
N900_RS16065 | 399407..399778 | + | 372 | WP_001164080.1 | nucleotide pyrophosphohydrolase | - |
N900_RS16070 | 399845..400270 | + | 426 | WP_001882332.1 | DUF1778 domain-containing protein | - |
N900_RS16075 | 400267..400800 | + | 534 | WP_000118351.1 | GNAT family N-acetyltransferase | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | catB9 | - | 304645..411088 | 106443 | |
inside | Integron | - | - | 309725..410760 | 101035 | ||
flank | IS/Tn | - | - | 391976..392956 | 980 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 96 a.a. Molecular weight: 10991.96 Da Isoelectric Point: 10.4934
>T45813 WP_000221354.1 NZ_CP006948:395616-395903 [Vibrio cholerae O1 str. KW3]
MTYKLKFLPAAQKEWSKLAPTIQSQFKKKLKERLENPHVPSAKLRGYDAVYKIKLRTAGYRLAYEVIDDEIVVYVLAVGK
RDKDAVYKKLASRFG
MTYKLKFLPAAQKEWSKLAPTIQSQFKKKLKERLENPHVPSAKLRGYDAVYKIKLRTAGYRLAYEVIDDEIVVYVLAVGK
RDKDAVYKKLASRFG
Download Length: 288 bp
>T45813 NZ_CP006948:395616-395903 [Vibrio cholerae O1 str. KW3]
ATGACCTATAAGTTAAAGTTTCTGCCGGCTGCGCAAAAGGAATGGAGTAAGTTAGCTCCGACAATTCAGAGTCAGTTCAA
GAAGAAGTTAAAGGAACGATTAGAAAATCCGCACGTCCCTTCGGCTAAGCTTCGAGGATACGACGCTGTTTACAAGATTA
AACTTCGTACGGCGGGTTATCGTTTAGCTTATGAGGTTATTGACGATGAGATAGTTGTCTATGTCCTTGCTGTCGGTAAA
CGTGACAAAGATGCTGTCTATAAAAAACTGGCTTCACGCTTCGGTTAG
ATGACCTATAAGTTAAAGTTTCTGCCGGCTGCGCAAAAGGAATGGAGTAAGTTAGCTCCGACAATTCAGAGTCAGTTCAA
GAAGAAGTTAAAGGAACGATTAGAAAATCCGCACGTCCCTTCGGCTAAGCTTCGAGGATACGACGCTGTTTACAAGATTA
AACTTCGTACGGCGGGTTATCGTTTAGCTTATGAGGTTATTGACGATGAGATAGTTGTCTATGTCCTTGCTGTCGGTAAA
CGTGACAAAGATGCTGTCTATAAAAAACTGGCTTCACGCTTCGGTTAG
Antitoxin
Download Length: 84 a.a. Molecular weight: 9136.29 Da Isoelectric Point: 4.0197
>AT45813 WP_001250179.1 NZ_CP006948:395375-395626 [Vibrio cholerae O1 str. KW3]
MRQVLANCSASISELKKNPTALLNEADGSAIAILNHNKPAAYLVPAETYEYLIDMLDDYELSQIVDSRRADLAQAVEVNI
DDL
MRQVLANCSASISELKKNPTALLNEADGSAIAILNHNKPAAYLVPAETYEYLIDMLDDYELSQIVDSRRADLAQAVEVNI
DDL
Download Length: 252 bp
>AT45813 NZ_CP006948:395375-395626 [Vibrio cholerae O1 str. KW3]
ATGAGACAAGTTTTAGCGAATTGCTCTGCAAGTATTTCAGAGTTAAAGAAGAACCCAACAGCTTTGTTGAATGAGGCTGA
TGGGTCTGCAATTGCAATTTTAAACCACAACAAGCCAGCGGCTTACCTTGTGCCAGCGGAAACGTATGAGTATCTCATCG
ATATGCTCGATGATTATGAGCTTTCCCAAATTGTCGATAGTCGCCGAGCTGACTTAGCACAAGCTGTGGAAGTAAATATT
GATGACCTATAA
ATGAGACAAGTTTTAGCGAATTGCTCTGCAAGTATTTCAGAGTTAAAGAAGAACCCAACAGCTTTGTTGAATGAGGCTGA
TGGGTCTGCAATTGCAATTTTAAACCACAACAAGCCAGCGGCTTACCTTGTGCCAGCGGAAACGTATGAGTATCTCATCG
ATATGCTCGATGATTATGAGCTTTCCCAAATTGTCGATAGTCGCCGAGCTGACTTAGCACAAGCTGTGGAAGTAAATATT
GATGACCTATAA
Structures
Toxin
Loading, please wait
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0X1KZS6 |
Antitoxin
Loading, please wait
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0X1KZS8 |