Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
Location | 119596..120211 | Replicon | chromosome |
Accession | NZ_CP013316 | ||
Organism | Vibrio cholerae strain M2140 |
Toxin (Protein)
Gene name | higB | Uniprot ID | Q9KMG5 |
Locus tag | ASZ83_RS14600 | Protein ID | WP_001162670.1 |
Coordinates | 119596..119883 (+) | Length | 96 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | ASZ83_RS14605 | Protein ID | WP_001232701.1 |
Coordinates | 119894..120211 (+) | Length | 106 a.a. |
Genomic Context
Location: 115088..115345 (258 bp)
Type: Others
Protein ID: WP_000861987.1
Type: Others
Protein ID: WP_000861987.1
Location: 115333..115635 (303 bp)
Type: Others
Protein ID: WP_000229318.1
Type: Others
Protein ID: WP_000229318.1
Location: 115924..116148 (225 bp)
Type: Others
Protein ID: WP_001894423.1
Type: Others
Protein ID: WP_001894423.1
Location: 116592..116711 (120 bp)
Type: Others
Protein ID: WP_071919600.1
Type: Others
Protein ID: WP_071919600.1
Location: 116715..116768 (54 bp)
Type: Others
Protein ID: Protein_123
Type: Others
Protein ID: Protein_123
Location: 117370..118374 (1005 bp)
Type: Others
Protein ID: WP_000964931.1
Type: Others
Protein ID: WP_000964931.1
Location: 119149..119329 (181 bp)
Type: Others
Protein ID: Protein_125
Type: Others
Protein ID: Protein_125
Location: 119596..119883 (288 bp)
Type: Toxin
Protein ID: WP_001162670.1
Type: Toxin
Protein ID: WP_001162670.1
Location: 119894..120211 (318 bp)
Type: Antitoxin
Protein ID: WP_001232701.1
Type: Antitoxin
Protein ID: WP_001232701.1
Location: 120208..120318 (111 bp)
Type: Others
Protein ID: WP_134814058.1
Type: Others
Protein ID: WP_134814058.1
Location: 120364..120903 (540 bp)
Type: Others
Protein ID: WP_000099372.1
Type: Others
Protein ID: WP_000099372.1
Location: 121048..121482 (435 bp)
Type: Others
Protein ID: WP_000453680.1
Type: Others
Protein ID: WP_000453680.1
Location: 121709..121987 (279 bp)
Type: Others
Protein ID: WP_001921601.1
Type: Others
Protein ID: WP_001921601.1
Location: 122239..122445 (207 bp)
Type: Others
Protein ID: Protein_132
Type: Others
Protein ID: Protein_132
Location: 122645..122746 (102 bp)
Type: Others
Protein ID: WP_001921603.1
Type: Others
Protein ID: WP_001921603.1
Location: 122736..123122 (387 bp)
Type: Others
Protein ID: WP_000703163.1
Type: Others
Protein ID: WP_000703163.1
Location: 123317..123568 (252 bp)
Type: Others
Protein ID: WP_001890111.1
Type: Others
Protein ID: WP_001890111.1
Location: 123541..123690 (150 bp)
Type: Others
Protein ID: WP_071908333.1
Type: Others
Protein ID: WP_071908333.1
Location: 123804..124247 (444 bp)
Type: Others
Protein ID: WP_000803902.1
Type: Others
Protein ID: WP_000803902.1
Location: 124251..124361 (111 bp)
Type: Others
Protein ID: WP_071908336.1
Type: Others
Protein ID: WP_071908336.1
Location: 124574..124726 (153 bp)
Type: Others
Protein ID: WP_001884520.1
Type: Others
Protein ID: WP_001884520.1
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
ASZ83_RS14555 | 115088..115345 | + | 258 | WP_000861987.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | - |
ASZ83_RS14560 | 115333..115635 | + | 303 | WP_000229318.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
ASZ83_RS14565 | 115924..116148 | + | 225 | WP_001894423.1 | DUF3709 domain-containing protein | - |
ASZ83_RS14570 | 116592..116711 | + | 120 | WP_071919600.1 | DUF645 family protein | - |
ASZ83_RS20010 | 116715..116768 | + | 54 | Protein_123 | DUF645 family protein | - |
ASZ83_RS14585 | 117370..118374 | + | 1005 | WP_000964931.1 | LD-carboxypeptidase | - |
ASZ83_RS14595 | 119149..119329 | + | 181 | Protein_125 | DUF645 family protein | - |
ASZ83_RS14600 | 119596..119883 | + | 288 | WP_001162670.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
ASZ83_RS14605 | 119894..120211 | + | 318 | WP_001232701.1 | HigA family addiction module antidote protein | Antitoxin |
ASZ83_RS20435 | 120208..120318 | + | 111 | WP_134814058.1 | DUF3265 domain-containing protein | - |
ASZ83_RS14615 | 120364..120903 | + | 540 | WP_000099372.1 | hypothetical protein | - |
ASZ83_RS14620 | 121048..121482 | + | 435 | WP_000453680.1 | GNAT family N-acetyltransferase | - |
ASZ83_RS14625 | 121709..121987 | + | 279 | WP_001921601.1 | DUF3709 domain-containing protein | - |
ASZ83_RS20030 | 122239..122445 | + | 207 | Protein_132 | DUF3709 domain-containing protein | - |
ASZ83_RS20035 | 122645..122746 | + | 102 | WP_001921603.1 | hypothetical protein | - |
ASZ83_RS14630 | 122736..123122 | + | 387 | WP_000703163.1 | VOC family protein | - |
ASZ83_RS14635 | 123317..123568 | + | 252 | WP_001890111.1 | TIGR03643 family protein | - |
ASZ83_RS14640 | 123541..123690 | + | 150 | WP_071908333.1 | DUF3265 domain-containing protein | - |
ASZ83_RS14645 | 123804..124247 | + | 444 | WP_000803902.1 | hypothetical protein | - |
ASZ83_RS14650 | 124251..124361 | + | 111 | WP_071908336.1 | DUF3265 domain-containing protein | - |
ASZ83_RS14655 | 124574..124726 | + | 153 | WP_001884520.1 | DUF645 family protein | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | - | 87981..224211 | 136230 | |
inside | Integron | - | - | 93061..221594 | 128533 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 96 a.a. Molecular weight: 11349.95 Da Isoelectric Point: 6.7187
>T58376 WP_001162670.1 NZ_CP013316:119596-119883 [Vibrio cholerae]
MALEFKDKWLEQFYEDDKRHRLIPSSIENALFRKLEILDAAQAESDLRIPPGNRFEHLEGNLKGWCSIRVNKQYRLIFQW
VDGVALNTYLDPHKY
MALEFKDKWLEQFYEDDKRHRLIPSSIENALFRKLEILDAAQAESDLRIPPGNRFEHLEGNLKGWCSIRVNKQYRLIFQW
VDGVALNTYLDPHKY
Download Length: 288 bp
>T58376 NZ_CP013316:119596-119883 [Vibrio cholerae]
ATGGCATTAGAATTTAAAGATAAGTGGTTAGAGCAGTTTTACGAGGATGATAAACGACATCGTTTAATTCCAAGTAGCAT
AGAGAATGCTCTATTTCGGAAGCTGGAAATCTTAGATGCAGCTCAAGCTGAATCAGACTTAAGAATTCCACCGGGTAATC
GTTTTGAACATCTTGAAGGAAATCTTAAAGGTTGGTGTTCAATTCGAGTGAACAAACAGTATCGTTTGATTTTTCAGTGG
GTTGATGGTGTTGCACTAAATACTTACTTAGACCCACATAAGTATTGA
ATGGCATTAGAATTTAAAGATAAGTGGTTAGAGCAGTTTTACGAGGATGATAAACGACATCGTTTAATTCCAAGTAGCAT
AGAGAATGCTCTATTTCGGAAGCTGGAAATCTTAGATGCAGCTCAAGCTGAATCAGACTTAAGAATTCCACCGGGTAATC
GTTTTGAACATCTTGAAGGAAATCTTAAAGGTTGGTGTTCAATTCGAGTGAACAAACAGTATCGTTTGATTTTTCAGTGG
GTTGATGGTGTTGCACTAAATACTTACTTAGACCCACATAAGTATTGA
Antitoxin
Download Length: 106 a.a. Molecular weight: 11705.63 Da Isoelectric Point: 10.4711
>AT58376 WP_001232701.1 NZ_CP013316:119894-120211 [Vibrio cholerae]
MRKTKRRPVSVGEMLKVEFLEPMGITSKALAEAMGVHRNTVSNLINGGVLTAPVAIKLAAALGNTPEFWLNIQHAVDLWD
TRNRYQEEAKFVKPLFVSLEQSART
MRKTKRRPVSVGEMLKVEFLEPMGITSKALAEAMGVHRNTVSNLINGGVLTAPVAIKLAAALGNTPEFWLNIQHAVDLWD
TRNRYQEEAKFVKPLFVSLEQSART
Download Length: 318 bp
>AT58376 NZ_CP013316:119894-120211 [Vibrio cholerae]
ATGCGTAAGACAAAACGTCGTCCAGTTAGCGTTGGGGAAATGTTAAAAGTTGAATTTCTTGAACCAATGGGCATCACATC
AAAAGCGCTCGCTGAAGCGATGGGCGTACACAGAAATACGGTCAGTAATTTAATTAATGGTGGTGTGTTAACAGCTCCGG
TAGCAATCAAGTTAGCCGCGGCATTAGGTAACACACCAGAATTTTGGCTTAACATTCAACATGCAGTTGATCTTTGGGAT
ACGAGAAATCGTTATCAAGAAGAAGCAAAGTTTGTAAAGCCGTTGTTTGTTTCGCTGGAACAAAGCGCACGTACATAA
ATGCGTAAGACAAAACGTCGTCCAGTTAGCGTTGGGGAAATGTTAAAAGTTGAATTTCTTGAACCAATGGGCATCACATC
AAAAGCGCTCGCTGAAGCGATGGGCGTACACAGAAATACGGTCAGTAATTTAATTAATGGTGGTGTGTTAACAGCTCCGG
TAGCAATCAAGTTAGCCGCGGCATTAGGTAACACACCAGAATTTTGGCTTAACATTCAACATGCAGTTGATCTTTGGGAT
ACGAGAAATCGTTATCAAGAAGAAGCAAAGTTTGTAAAGCCGTTGTTTGTTTCGCTGGAACAAAGCGCACGTACATAA
Structures
Toxin
Loading, please wait
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0F2HI36 |
Antitoxin
Loading, please wait
Source | ID | Structure |
---|---|---|
No matching records found |