Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | relBE/ParE-YafN |
Location | 580896..581424 | Replicon | chromosome |
Accession | NZ_CP013310 | ||
Organism | Vibrio cholerae strain E1162 |
Toxin (Protein)
Gene name | relE | Uniprot ID | A0A0X1KZS6 |
Locus tag | ASZ87_RS17680 | Protein ID | WP_000221354.1 |
Coordinates | 581137..581424 (+) | Length | 96 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | A0A0X1KZS8 |
Locus tag | ASZ87_RS17675 | Protein ID | WP_001250179.1 |
Coordinates | 580896..581147 (+) | Length | 84 a.a. |
Genomic Context
Location: 576164..576478 (315 bp)
Type: Others
Protein ID: WP_000071008.1
Type: Others
Protein ID: WP_000071008.1
Location: 576615..577049 (435 bp)
Type: Others
Protein ID: WP_000256036.1
Type: Others
Protein ID: WP_000256036.1
Location: 577217..577372 (156 bp)
Type: Others
Protein ID: WP_000751734.1
Type: Others
Protein ID: WP_000751734.1
Location: 578545..578851 (307 bp)
Type: Others
Protein ID: Protein_610
Type: Others
Protein ID: Protein_610
Location: 578988..579680 (693 bp)
Type: Others
Protein ID: WP_001047169.1
Type: Others
Protein ID: WP_001047169.1
Location: 579680..580081 (402 bp)
Type: Others
Protein ID: WP_000351248.1
Type: Others
Protein ID: WP_000351248.1
Location: 580051..580194 (144 bp)
Type: Others
Protein ID: WP_071908341.1
Type: Others
Protein ID: WP_071908341.1
Location: 580269..580682 (414 bp)
Type: Others
Protein ID: WP_000049417.1
Type: Others
Protein ID: WP_000049417.1
Location: 580896..581147 (252 bp)
Type: Antitoxin
Protein ID: WP_001250179.1
Type: Antitoxin
Protein ID: WP_001250179.1
Location: 581137..581424 (288 bp)
Type: Toxin
Protein ID: WP_000221354.1
Type: Toxin
Protein ID: WP_000221354.1
Location: 581552..582007 (456 bp)
Type: Others
Protein ID: WP_001245327.1
Type: Others
Protein ID: WP_001245327.1
Location: 582329..582481 (153 bp)
Type: Others
Protein ID: WP_001884520.1
Type: Others
Protein ID: WP_001884520.1
Location: 583680..584348 (669 bp)
Type: Others
Protein ID: WP_000043871.1
Type: Others
Protein ID: WP_000043871.1
Location: 584500..584787 (288 bp)
Type: Others
Protein ID: WP_000426470.1
Type: Others
Protein ID: WP_000426470.1
Location: 584928..585299 (372 bp)
Type: Others
Protein ID: WP_001164080.1
Type: Others
Protein ID: WP_001164080.1
Location: 585366..585791 (426 bp)
Type: Others
Protein ID: WP_001882332.1
Type: Others
Protein ID: WP_001882332.1
Location: 585788..586321 (534 bp)
Type: Others
Protein ID: WP_000118351.1
Type: Others
Protein ID: WP_000118351.1
Location: 577497..578477 (981 bp)
Type: Others
Protein ID: WP_000019370.1
Type: Others
Protein ID: WP_000019370.1
Location: 582683..583180 (498 bp)
Type: Others
Protein ID: WP_000982260.1
Type: Others
Protein ID: WP_000982260.1
Location: 583177..583449 (273 bp)
Type: Others
Protein ID: WP_000246253.1
Type: Others
Protein ID: WP_000246253.1
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
ASZ87_RS17625 | 576164..576478 | + | 315 | WP_000071008.1 | DNA-binding transcriptional regulator | - |
ASZ87_RS17630 | 576615..577049 | + | 435 | WP_000256036.1 | GNAT family N-acetyltransferase | - |
ASZ87_RS20915 | 577217..577372 | + | 156 | WP_000751734.1 | hypothetical protein | - |
ASZ87_RS17645 | 577497..578477 | - | 981 | WP_000019370.1 | IS5-like element ISVch5 family transposase | - |
ASZ87_RS17650 | 578545..578851 | + | 307 | Protein_610 | CatB-related O-acetyltransferase | - |
ASZ87_RS17655 | 578988..579680 | + | 693 | WP_001047169.1 | GNAT family N-acetyltransferase | - |
ASZ87_RS17660 | 579680..580081 | + | 402 | WP_000351248.1 | type II toxin-antitoxin system death-on-curing family toxin | - |
ASZ87_RS20820 | 580051..580194 | + | 144 | WP_071908341.1 | DUF3265 domain-containing protein | - |
ASZ87_RS17670 | 580269..580682 | + | 414 | WP_000049417.1 | VOC family protein | - |
ASZ87_RS17675 | 580896..581147 | + | 252 | WP_001250179.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
ASZ87_RS17680 | 581137..581424 | + | 288 | WP_000221354.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
ASZ87_RS17685 | 581552..582007 | + | 456 | WP_001245327.1 | GNAT family N-acetyltransferase | - |
ASZ87_RS17695 | 582329..582481 | + | 153 | WP_001884520.1 | DUF645 family protein | - |
ASZ87_RS17700 | 582683..583180 | - | 498 | WP_000982260.1 | GNAT family N-acetyltransferase | - |
ASZ87_RS17705 | 583177..583449 | - | 273 | WP_000246253.1 | DUF1778 domain-containing protein | - |
ASZ87_RS17710 | 583680..584348 | + | 669 | WP_000043871.1 | hypothetical protein | - |
ASZ87_RS17715 | 584500..584787 | + | 288 | WP_000426470.1 | hypothetical protein | - |
ASZ87_RS17720 | 584928..585299 | + | 372 | WP_001164080.1 | nucleotide pyrophosphohydrolase | - |
ASZ87_RS17725 | 585366..585791 | + | 426 | WP_001882332.1 | DUF1778 domain-containing protein | - |
ASZ87_RS17730 | 585788..586321 | + | 534 | WP_000118351.1 | GNAT family N-acetyltransferase | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | catB9 | - | 435534..596659 | 161125 | |
inside | Integron | - | - | 440614..596283 | 155669 | ||
flank | IS/Tn | - | - | 577497..578477 | 980 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 96 a.a. Molecular weight: 10991.96 Da Isoelectric Point: 10.4934
>T58317 WP_000221354.1 NZ_CP013310:581137-581424 [Vibrio cholerae]
MTYKLKFLPAAQKEWSKLAPTIQSQFKKKLKERLENPHVPSAKLRGYDAVYKIKLRTAGYRLAYEVIDDEIVVYVLAVGK
RDKDAVYKKLASRFG
MTYKLKFLPAAQKEWSKLAPTIQSQFKKKLKERLENPHVPSAKLRGYDAVYKIKLRTAGYRLAYEVIDDEIVVYVLAVGK
RDKDAVYKKLASRFG
Download Length: 288 bp
>T58317 NZ_CP013310:581137-581424 [Vibrio cholerae]
ATGACCTATAAGTTAAAGTTTCTGCCGGCTGCGCAAAAGGAATGGAGTAAGTTAGCTCCGACAATTCAGAGTCAGTTCAA
GAAGAAGTTAAAGGAACGATTAGAAAATCCGCACGTCCCTTCGGCTAAGCTTCGAGGATACGACGCTGTTTACAAGATTA
AACTTCGTACGGCGGGTTATCGTTTAGCTTATGAGGTTATTGACGATGAGATAGTTGTCTATGTCCTTGCTGTCGGTAAA
CGTGACAAAGATGCTGTCTATAAAAAACTGGCTTCACGCTTCGGTTAG
ATGACCTATAAGTTAAAGTTTCTGCCGGCTGCGCAAAAGGAATGGAGTAAGTTAGCTCCGACAATTCAGAGTCAGTTCAA
GAAGAAGTTAAAGGAACGATTAGAAAATCCGCACGTCCCTTCGGCTAAGCTTCGAGGATACGACGCTGTTTACAAGATTA
AACTTCGTACGGCGGGTTATCGTTTAGCTTATGAGGTTATTGACGATGAGATAGTTGTCTATGTCCTTGCTGTCGGTAAA
CGTGACAAAGATGCTGTCTATAAAAAACTGGCTTCACGCTTCGGTTAG
Antitoxin
Download Length: 84 a.a. Molecular weight: 9136.29 Da Isoelectric Point: 4.0197
>AT58317 WP_001250179.1 NZ_CP013310:580896-581147 [Vibrio cholerae]
MRQVLANCSASISELKKNPTALLNEADGSAIAILNHNKPAAYLVPAETYEYLIDMLDDYELSQIVDSRRADLAQAVEVNI
DDL
MRQVLANCSASISELKKNPTALLNEADGSAIAILNHNKPAAYLVPAETYEYLIDMLDDYELSQIVDSRRADLAQAVEVNI
DDL
Download Length: 252 bp
>AT58317 NZ_CP013310:580896-581147 [Vibrio cholerae]
ATGAGACAAGTTTTAGCGAATTGCTCTGCAAGTATTTCAGAGTTAAAGAAGAACCCAACAGCTTTGTTGAATGAGGCTGA
TGGGTCTGCAATTGCAATTTTAAACCACAACAAGCCAGCGGCTTACCTTGTGCCAGCGGAAACGTATGAGTATCTCATCG
ATATGCTCGATGATTATGAGCTTTCCCAAATTGTCGATAGTCGCCGAGCTGACTTAGCACAAGCTGTGGAAGTAAATATT
GATGACCTATAA
ATGAGACAAGTTTTAGCGAATTGCTCTGCAAGTATTTCAGAGTTAAAGAAGAACCCAACAGCTTTGTTGAATGAGGCTGA
TGGGTCTGCAATTGCAATTTTAAACCACAACAAGCCAGCGGCTTACCTTGTGCCAGCGGAAACGTATGAGTATCTCATCG
ATATGCTCGATGATTATGAGCTTTCCCAAATTGTCGATAGTCGCCGAGCTGACTTAGCACAAGCTGTGGAAGTAAATATT
GATGACCTATAA
Structures
Toxin
Loading, please wait
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0X1KZS6 |
Antitoxin
Loading, please wait
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0X1KZS8 |