Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | parDE/ParE-RHH |
Location | 440399..440937 | Replicon | chromosome |
Accession | NZ_LT992489 | ||
Organism | Vibrio cholerae strain 4295STDY6534232 |
Toxin (Protein)
Gene name | parE | Uniprot ID | Q9KMJ0 |
Locus tag | DG176_RS16640 | Protein ID | WP_000802136.1 |
Coordinates | 440638..440937 (+) | Length | 100 a.a. |
Antitoxin (Protein)
Gene name | parD | Uniprot ID | P58093 |
Locus tag | DG176_RS16635 | Protein ID | WP_001107719.1 |
Coordinates | 440399..440641 (+) | Length | 81 a.a. |
Genomic Context
Location: 440399..440641 (243 bp)
Type: Antitoxin
Protein ID: WP_001107719.1
Type: Antitoxin
Protein ID: WP_001107719.1
Location: 440638..440937 (300 bp)
Type: Toxin
Protein ID: WP_000802136.1
Type: Toxin
Protein ID: WP_000802136.1
Location: 435815..435955 (141 bp)
Type: Others
Protein ID: WP_001883049.1
Type: Others
Protein ID: WP_001883049.1
Location: 435921..436856 (936 bp)
Type: Others
Protein ID: WP_000051985.1
Type: Others
Protein ID: WP_000051985.1
Location: 437137..437736 (600 bp)
Type: Others
Protein ID: WP_000429495.1
Type: Others
Protein ID: WP_000429495.1
Location: 437891..438157 (267 bp)
Type: Others
Protein ID: WP_000937852.1
Type: Others
Protein ID: WP_000937852.1
Location: 438371..439054 (684 bp)
Type: Others
Protein ID: WP_000877436.1
Type: Others
Protein ID: WP_000877436.1
Location: 439478..439570 (93 bp)
Type: Others
Protein ID: WP_014164112.1
Type: Others
Protein ID: WP_014164112.1
Location: 439592..440170 (579 bp)
Type: Others
Protein ID: WP_000110120.1
Type: Others
Protein ID: WP_000110120.1
Location: 441065..441460 (396 bp)
Type: Others
Protein ID: WP_000870857.1
Type: Others
Protein ID: WP_000870857.1
Location: 441674..441853 (180 bp)
Type: Others
Protein ID: WP_001883058.1
Type: Others
Protein ID: WP_001883058.1
Location: 442431..442541 (111 bp)
Type: Others
Protein ID: WP_079857360.1
Type: Others
Protein ID: WP_079857360.1
Location: 442551..443249 (699 bp)
Type: Others
Protein ID: WP_001890502.1
Type: Others
Protein ID: WP_001890502.1
Location: 443372..443998 (627 bp)
Type: Others
Protein ID: WP_000365424.1
Type: Others
Protein ID: WP_000365424.1
Location: 444040..444132 (93 bp)
Type: Others
Protein ID: WP_014378730.1
Type: Others
Protein ID: WP_014378730.1
Location: 444147..444620 (474 bp)
Type: Others
Protein ID: WP_001161076.1
Type: Others
Protein ID: WP_001161076.1
Location: 444820..445002 (183 bp)
Type: Others
Protein ID: WP_000923182.1
Type: Others
Protein ID: WP_000923182.1
Location: 445063..445191 (129 bp)
Type: Others
Protein ID: WP_071908338.1
Type: Others
Protein ID: WP_071908338.1
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
DG176_RS16580 | 435815..435955 | - | 141 | WP_001883049.1 | DUF3265 domain-containing protein | - |
DG176_RS16585 | 435921..436856 | - | 936 | WP_000051985.1 | restriction endonuclease | - |
DG176_RS16590 | 437137..437736 | - | 600 | WP_000429495.1 | hypothetical protein | - |
DG176_RS16600 | 437891..438157 | - | 267 | WP_000937852.1 | hypothetical protein | - |
DG176_RS16610 | 438371..439054 | - | 684 | WP_000877436.1 | hypothetical protein | - |
DG176_RS16620 | 439478..439570 | - | 93 | WP_014164112.1 | DUF3265 domain-containing protein | - |
DG176_RS16625 | 439592..440170 | - | 579 | WP_000110120.1 | hypothetical protein | - |
DG176_RS16635 | 440399..440641 | + | 243 | WP_001107719.1 | type II toxin-antitoxin system ParD family antitoxin | Antitoxin |
DG176_RS16640 | 440638..440937 | + | 300 | WP_000802136.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
DG176_RS16645 | 441065..441460 | - | 396 | WP_000870857.1 | DUF3465 domain-containing protein | - |
DG176_RS16650 | 441674..441853 | - | 180 | WP_001883058.1 | DUF645 family protein | - |
DG176_RS16665 | 442431..442541 | - | 111 | WP_079857360.1 | DUF3265 domain-containing protein | - |
DG176_RS16670 | 442551..443249 | - | 699 | WP_001890502.1 | hypothetical protein | - |
DG176_RS16675 | 443372..443998 | - | 627 | WP_000365424.1 | LysE family translocator | - |
DG176_RS16680 | 444040..444132 | - | 93 | WP_014378730.1 | DUF3265 domain-containing protein | - |
DG176_RS16685 | 444147..444620 | - | 474 | WP_001161076.1 | GrpB family protein | - |
DG176_RS16690 | 444820..445002 | - | 183 | WP_000923182.1 | DUF645 family protein | - |
DG176_RS19830 | 445063..445191 | - | 129 | WP_071908338.1 | general secretion pathway protein GspI | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | catB9 | - | 379325..476297 | 96972 | |
inside | Integron | catB9 | - | 379701..469509 | 89808 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 100 a.a. Molecular weight: 11589.29 Da Isoelectric Point: 9.9232
>T294380 WP_000802136.1 NZ_LT992489:440638-440937 [Vibrio cholerae]
MKPFNLTVAAKADLRDIALFTQRRWGKEQRNVYLKQFDDSFWLLAENPDIGKSCDEIREGYRKFPQGSHVIFYQQTGSQQ
IRVIRILHKSMDVNPIFGA
MKPFNLTVAAKADLRDIALFTQRRWGKEQRNVYLKQFDDSFWLLAENPDIGKSCDEIREGYRKFPQGSHVIFYQQTGSQQ
IRVIRILHKSMDVNPIFGA
Download Length: 300 bp
>T294380 NZ_LT992489:440638-440937 [Vibrio cholerae]
ATGAAACCATTTAATCTTACCGTCGCCGCCAAAGCCGATTTACGTGATATTGCTTTATTCACTCAACGACGCTGGGGAAA
AGAGCAGCGAAATGTTTATTTAAAGCAATTCGATGATTCCTTTTGGCTTTTAGCGGAAAATCCCGACATTGGTAAATCAT
GCGATGAAATCCGAGAGGGATACAGAAAATTTCCCCAAGGGAGTCACGTCATCTTTTATCAGCAAACCGGCAGCCAACAA
ATCAGGGTGATCCGAATTCTTCATAAGAGCATGGATGTGAACCCAATATTCGGCGCATAA
ATGAAACCATTTAATCTTACCGTCGCCGCCAAAGCCGATTTACGTGATATTGCTTTATTCACTCAACGACGCTGGGGAAA
AGAGCAGCGAAATGTTTATTTAAAGCAATTCGATGATTCCTTTTGGCTTTTAGCGGAAAATCCCGACATTGGTAAATCAT
GCGATGAAATCCGAGAGGGATACAGAAAATTTCCCCAAGGGAGTCACGTCATCTTTTATCAGCAAACCGGCAGCCAACAA
ATCAGGGTGATCCGAATTCTTCATAAGAGCATGGATGTGAACCCAATATTCGGCGCATAA
Antitoxin
Download Length: 81 a.a. Molecular weight: 8964.84 Da Isoelectric Point: 4.1677
>AT294380 WP_001107719.1 NZ_LT992489:440399-440641 [Vibrio cholerae]
MAKNTSITLGEHFDGFITSQIQSGRYGSASEVIRSALRLLENQETKLQSLRQLLIEGEQSGDADYDLDSFINELDSENIR
MAKNTSITLGEHFDGFITSQIQSGRYGSASEVIRSALRLLENQETKLQSLRQLLIEGEQSGDADYDLDSFINELDSENIR
Download Length: 243 bp
>AT294380 NZ_LT992489:440399-440641 [Vibrio cholerae]
ATGGCTAAAAATACAAGTATCACTCTTGGTGAACACTTCGATGGCTTTATTACAAGCCAAATACAAAGTGGGCGTTACGG
CTCAGCAAGTGAAGTCATTCGCTCTGCGCTACGTCTACTCGAAAACCAAGAAACCAAACTACAGTCACTCCGTCAACTAC
TTATTGAAGGAGAGCAAAGTGGTGACGCTGATTATGACCTTGATAGCTTCATCAATGAACTCGATAGTGAAAACATTCGA
TGA
ATGGCTAAAAATACAAGTATCACTCTTGGTGAACACTTCGATGGCTTTATTACAAGCCAAATACAAAGTGGGCGTTACGG
CTCAGCAAGTGAAGTCATTCGCTCTGCGCTACGTCTACTCGAAAACCAAGAAACCAAACTACAGTCACTCCGTCAACTAC
TTATTGAAGGAGAGCAAAGTGGTGACGCTGATTATGACCTTGATAGCTTCATCAATGAACTCGATAGTGAAAACATTCGA
TGA
Structures
Toxin
Loading, please wait
Source | ID | Structure |
---|---|---|
PDB | 7R5A |
Antitoxin
Loading, please wait
Source | ID | Structure |
---|---|---|
PDB | 7R5A | |
PDB | 7B22 | |
AlphaFold DB | A0A151JFU4 |